SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103922 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103922
Domain Number 1 Region: 115-409
Classification Level Classification E-value
Superfamily ARM repeat 6.53e-29
Family Armadillo repeat 0.049
Further Details:      
 
Domain Number 2 Region: 400-480
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.36e-18
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 600-725
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000249
Family Toll/Interleukin receptor TIR domain 0.008
Further Details:      
 
Domain Number 4 Region: 483-543
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000607
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103922   Gene: ENSMUSG00000050132   Transcript: ENSMUST00000108287
Sequence length 764
Comment pep:known chromosome:NCBIM37:11:78285832:78310960:-1 gene:ENSMUSG00000050132 transcript:ENSMUST00000108287
Sequence
MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTE
VQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAI
RLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVEL
ARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALANCALHGGQT
VQRCMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVEHSGTLALVEPLV
ASLDPGRFARCLVDASDTSQGRGPDDLQSLVLLLDSSRLEAQCIGAFYLCAEAAIKSLQG
KTKVFSDIGAIQSLKRLVSYSTNGTTSALAKRALRLLGEEVPRRILPCVASWKEAEVQTW
LQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMKSSITRKRFFRELTELKTFASYA
TCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIRLGVHRTRILS
AARGHFAQTGLRSLRRPSLHDDGPRDKQWGRATLTSMSLSLAPEMLHSPLPCTGGKLSGD
TPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVIAARNFVLV
LSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQALPEDMQAVLTFNG
IKWSHEYQEATIEKIIRFLQGRPSQDSSAGSDTSLEGATPMGLP
Download sequence
Identical sequences NP_001161993.1.92730 ENSMUSP00000103922 10090.ENSMUSP00000103922 ENSMUSP00000103922 ENSMUSP00000103922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]