SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104034 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104034
Domain Number 1 Region: 322-475
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-40
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000104034
Domain Number - Region: 277-324
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.000615
Family DEK C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104034   Gene: ENSMUSG00000037926   Transcript: ENSMUST00000108397
Sequence length 1450
Comment pep:known chromosome:NCBIM37:11:77029927:77269050:1 gene:ENSMUSG00000037926 transcript:ENSMUST00000108397
Sequence
MALVTVQRSPTPSTTSSPCASSSYLEDSESAALLCCEYGESEIFSDFNEADSGEEECRSQ
PRSISESFLTVKGAALFLPRGNGSSTPRVSHRRNKHAGDLQQHLQAMFILLRPEDNIRLA
VRLESTYQNRTRYMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHLD
GDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARMHNYYPGSLFLTWVSYYESHI
NSDQSSVNEWNAMQDVQSHRPDSPALFTDIPTERERTERLIKTKLREIMMQKDLENITSK
EIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNRG
VRYILNVTREIDNFFPGVFEYHNIRVYDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCK
MGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKPNPSFMRQLEEYQGILLASKQRH
NKLWRSHSDSDLSDHHEPICKPGLELNKKEMTTSADQIAEVKTVENLAAMPTVFMEHVVP
QDANQKGLHTKERVICLEFSSQEFRAGQIEDELNLNDINGCSSGCCLSESKLPLDNCHAS
KALLQPGQAPDIANKFPDLAVEDLETDALKADMNVHLLPMEELTSRLKDLPMSPDLESPS
PQASCQAAISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRIEELGGGRSEGCRLSVIE
VAASEMAADDQRSSSLSNTPHASEESSVDEDQSKAITELVSPDIIMQSHSENAISVKEIV
TEIESISQGVGQVQLKGDILSNPCHTPKKSTIHELPLERVPAPESKPGHWEQDESFCSVQ
PELARDSGKCAPEEGCLTTHSSTADLEEEEPVEGEHDWGPGMHSGAKWCPGSVRRATLEF
EERLRQEQENHGTASAGPTLSNRKNSKNDSSVADLMPKWKSDETTPEHSFFLKEAEPSKG
KGKCSGSEAGSLSHCERNPTMPDCELLEHHSLPAPQDCLGSDSRSKKQEGDLKKQRAVVP
NQECDTQAILLPLPKKIEIIEYTPTVTSLGHTEPGGEATPSKEGEKQGLRKVKMEQSITM
FCALDENLNRTLEPSQVSLHPQVLPLPHSSSECDRPADPNPMLSSPQDKGDCPSTPFKTA
APFVSCSTQGASFSLDYLLPHSVVHLEGCTEQSSATDNELSPEQASWEDSRGHFLSSGSG
MAHTSSPLTNEDLSLINKLGDSVGVLQKKLDPSPEACRIPHSSSSENIRDLSHSRGVVKE
HAKEIESRVIFQAGFSKTSQMKRSASLAKLGYLDLCKDYLPDRELVSSESPHLKLLQPFL
RTDSGMHALMAHEPSESAGAQQNPQPTKYSVEQLKTSECIVQSKPVERPSVQYAKEFGYS
QQCLLPKARPELTSSEGGLPLLQTQGLQYTGPSPGLAVAPRQQHGRTHPLRRLKRANDKK
RTTNPFYNTM
Download sequence
Identical sequences XP_006533290.1.92730 ENSMUSP00000104034 10090.ENSMUSP00000104034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]