SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104408 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104408
Domain Number 1 Region: 104-233
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-44
Family Regulator of G-protein signaling, RGS 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104408   Gene: ENSMUSG00000002458   Transcript: ENSMUST00000108778
Sequence length 243
Comment pep:novel chromosome:NCBIM37:2:181423209:181426522:-1 gene:ENSMUSG00000002458 transcript:ENSMUST00000108778
Sequence
MVSARILCCSEGPELAPQNLGNPLHSPMPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGP
PSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPKEVQSWAQSFDK
LMHSPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPK
EVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQS
SEA
Download sequence
Identical sequences B7ZCT1
ENSMUSP00000104408 10090.ENSMUSP00000104408 ENSMUSP00000104408 ENSMUSP00000104403 NP_001278134.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]