SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104462 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104462
Domain Number 1 Region: 60-233
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-29
Family FAD-linked reductases, N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104462   Gene: ENSMUSG00000069873   Transcript: ENSMUST00000108834
Sequence length 305
Comment pep:novel chromosome:NCBIM37:11:58088301:58107791:1 gene:ENSMUSG00000069873 transcript:ENSMUST00000108834
Sequence
MLPAPGRLLAMFPGWLALIFLSVLSLDTQAFNRKLVKCFEDPQYEELLQLARNGLGQTAE
RKQVVVIGAGMAGLTAAKILQDAGHQVTVLEASGRVGGRIETHRVPGAHWYIELGAMRIP
INHRLSHELIKKFGLMLKEFCPCNNQTWVLVNGVRQRSGAVQADPGLLGYSVRADEVGKT
AEQLFDASLRKIVEELKNSSCQEVLEKYDSFSTKEYLIKVGNLSRGAVQMIGDMLNTDSG
YYEAFTETLRSMKSLEALTNSPRLCTILSSQGLFGSTHQQRKWKCLETVFTSPTGHLTLC
CPGRG
Download sequence
Identical sequences A0A140LJK6
ENSMUSP00000104462 ENSMUSP00000104462 10090.ENSMUSP00000104462 ENSMUSP00000104462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]