SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104860 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104860
Domain Number 1 Region: 357-618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-77
Family Protein kinases, catalytic subunit 0.000000000334
Further Details:      
 
Domain Number 2 Region: 6-153
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-41
Family Pleckstrin-homology domain (PH domain) 0.0000553
Further Details:      
 
Domain Number 3 Region: 240-387
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-31
Family SH2 domain 0.00000129
Further Details:      
 
Domain Number 4 Region: 181-262
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-16
Family SH3-domain 0.0000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104860   Gene: ENSMUSG00000020395   Transcript: ENSMUST00000109237
Sequence length 625
Comment pep:known chromosome:NCBIM37:11:46138652:46202995:-1 gene:ENSMUSG00000020395 transcript:ENSMUST00000109237
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQTLVYLQVVHDNYLLYVFAPDCESRQRWVLTLKEETRNNN
SLVSKYHPNFWMDGRWRCCSQLEKPAVGCAPYDPSKNASKKPLPPTPEDNRRSFQEPEET
LVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSPNNL
ETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHI
KETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCSWRQKAPVTAGLRYGK
WVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSH
PKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEK
ACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRY
SSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASCHVYQIMNHCW
KEKPEDRPPFSQLLSQLAEIAEAGL
Download sequence
Identical sequences Q03526
10090.ENSMUSP00000104860 NP_001268894.1.92730 ENSMUSP00000104860 ENSMUSP00000104860 ENSMUSP00000098864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]