SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105053 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105053
Domain Number 1 Region: 826-1061
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-56
Family DBL homology domain (DH-domain) 0.0000341
Further Details:      
 
Domain Number 2 Region: 1058-1187
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-34
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 3 Region: 643-699
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000174
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000105053
Domain Number - Region: 133-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00601
Family Ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105053   Gene: ENSMUSG00000021662   Transcript: ENSMUST00000109426
Sequence length 1700
Comment pep:known chromosome:NCBIM37:13:98668550:98976120:-1 gene:ENSMUSG00000021662 transcript:ENSMUST00000109426
Sequence
MELSCSEVPLYGQKTVYAKFGKNVYLPEDAEFYFVYGGSHQRHVVIADRVQDNVLQSSIP
GHWLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQADRLTACSHQTLLT
PFALTVEALPALDEELVLALTQLELPLGWTVLGNSSLEVSLHRESLLHLAVRWALPKLFH
FLLCLPGGVKALKLPNEEATTPLDLALQGGHSTLVEDITNFQGSHSPGFSRLRLNEEATL
QFVHSSETLTLTVNHTAEHLLEADIKLFRKYFWDRAFLVKALEQEAKTEKATMPSGAAET
EEEVRNLESGRSPSEEEEDAKSIKSQVDGPSEHEDQDRLPLDRSFDGLKKSKHVPASLAA
GQLSDVLNGGDEVYANCMVIDQVGDLDINYINLEGLSTHTSPESGRSMLGPQACMHTLPP
DTSPCGRPLIENSEGTLDAAASQSFVTPSSSRTSNLNLSFGLHGFEKEQSHLKKRSSSLD
ALVADSEGEGGSEPPICYAVGSQSSPRTGLPSGDELDSFETNTEPDCNISRTESLSLSST
LHSKESLLSGIRSRSYSCSSPKISSGKSRLVRDFTVCSTSEEQRSYSFQEPPGEKRIQEE
EWDEYVIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKMKNKDTKEKEKMNRHQFVPGTFS
GVLQCSGCDKTLLGKESLQCANCKANTHKGCKDAVPPCTKKFQEKYNKNKPQSILGSSSV
RDVPAPGLSLHPSSSMPIGLPAGRKEFAAQVHPLSRSVPGTTLESFRRAVTSLESEGDSW
RSRSHSDELFQSMGSSPSTESFMMEDVVDSSLWIDLSSDAQEFEAESWSLVVDPSFCSRQ
EKDVIKRQDVIFELMQTEVHHIQTLLIMSEVFRKGMKEELQLDHSTVDKIFPCLDELLET
HRHFFFSMKERRQESCAGSDRNFVINQIGDILVQQFSEENASKMKRIYGEFCSHHKEAMS
LFKELQQNKKFQNFIKIRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKERTEE
HRDLCKALGLIKDMIAAVDLKVSEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQALLSQ
ERALLHDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQKLIA
REVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEEGGRTSESDE
ERRKAEARVAKIQQCQEILSNQDQQICTYLEEKLHIYAELGELSGFEDVHLEPHLLIKPD
PGEPPQAASLLAAALREAESLQVAVKASKMGDVSQSSEESPGGTVLMDTPSTQDVPASPT
ASLVTEGTEGRGCWDVDPGLQGVVTDLAVSDAGEKVEYRSFSGSSQSEIIQAIQNLTRLL
YSLQAALTIQDSHIEIHKLVLQQRESLAPSHSFRGGPLQDQEKSRYLEKQREELANIHKL
QHQFQQEQRRWHRTCDQQQREQEAQESWLQARERECQSQEELLLRHRSELDHQLQEYQQS
LERLREGQRMVERERQKMRVQQGLLGHCKHSRQRSLPAVFSPGSKEVTELNRAESLCHEN
SFFINEAFGHMSLNTSNKPNPSGVPWDAHPLEGSHFDLARTSESPTELKIDISQPPDVNS
ELWTTGPGHQRPALQENSKESYKNVADLDSFQSESSSPQDSNQRGPQPQTLTTEAKLSLP
MAAGHGGDAGDGAEENILYL
Download sequence
Identical sequences G5E8P2
ENSMUSP00000105053 ENSMUSP00000105053 10090.ENSMUSP00000105053 ENSMUSP00000105053 NP_036156.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]