SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105536 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105536
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-42
Family Third domain of FERM 0.000000404
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-37
Family Second domain of FERM 0.000000688
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 503-596
Classification Level Classification E-value
Superfamily Moesin tail domain 2.62e-24
Family Moesin tail domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105536   Gene: ENSMUSG00000009073   Transcript: ENSMUST00000109910
Sequence length 596
Comment pep:known chromosome:NCBIM37:11:4665848:4749539:-1 gene:ENSMUSG00000009073 transcript:ENSMUST00000109910
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDVLHSESSDRGGPSSKHNTIKKLTLQSAKSRVAFFEEL
Download sequence
Identical sequences P46662
NP_035028.2.92730 ENSMUSP00000105536 ENSMUSP00000055033 10090.ENSMUSP00000105536 ENSMUSP00000105536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]