SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105632 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105632
Domain Number 1 Region: 541-782
Classification Level Classification E-value
Superfamily VPS9 domain 3.14e-54
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 93-214
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-17
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 799-878
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000101
Family Ras-binding domain, RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105632   Gene: ENSMUSG00000001768   Transcript: ENSMUST00000110005
Sequence length 903
Comment pep:known chromosome:NCBIM37:2:145611716:145713352:1 gene:ENSMUSG00000001768 transcript:ENSMUST00000110005
Sequence
MSAWTMGAQGLDKRGSFFKLIDTIASEIGELKREMVQTDISRENGLEPSETHSMVRHKDG
GYSEDKDGKTCPRDSGYDSLSNRLSILDRLLHTHPIWLQLSLSEEEAAEVLQAQPPGIFL
VRKSSKMQKKVLSLRLPCEFGAPLKEFTIKESTYTFSLEGSGISFADLFRLIAFYCISRD
VLPFTLKLPYAISTAKTESQLEELAQLGLNFWSSSADNKPLNSPPPHRPLPSAGICPASL
RQLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVHSQDLSTGPKRPSTRTPNANG
TERPRSPPPRPPPPAINSLHTSPGLSRTEPQTSMPETVNHSKHGNVALLGTKPTPIPPPR
LKKQASFLEAESSAKTLTARRPSRRSEPEPELELELEMGTAGHAGGAPPRDAPGDCTRAP
PPGSESQPPPCHGARQRLSDMSLSTSSSDSLEFDRSMPLYGYEADTTSSLEDYEGESDQE
TMAPPIKSKKKRNSSFVLPKLVKSQLRKMSGVFSSFMTPEKRMVRRIAELSRDKCTYFGC
LVQDYVSFLKENKECHVSSTDMLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQIDVVL
EKAMHKCILKPLKGHVEAMLKDFHTADGSWKQLKENLQLVRQRNPQELGVFAPTPDLMEL
EKIKLKFMTMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVIAQCDM
LELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSEARDTLRQW
HKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQLCAEKFKVEDP
EEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKSDPYGVIFQNGEDL
TPS
Download sequence
Identical sequences Q9D684
XP_006500332.1.92730 XP_006500333.1.92730 XP_006500334.1.92730 ENSMUSP00000105632 10090.ENSMUSP00000105632 ENSMUSP00000105632 ENSMUSP00000105632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]