SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105660 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105660
Domain Number 1 Region: 452-736
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-82
Family Protein kinases, catalytic subunit 0.000000000133
Further Details:      
 
Domain Number 2 Region: 948-1086
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 3.4e-59
Family FAT domain of focal adhesion kinase 0.00000019
Further Details:      
 
Domain Number 3 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 1.79e-40
Family Second domain of FERM 0.000000439
Further Details:      
 
Domain Number 4 Region: 31-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-39
Family First domain of FERM 0.00000264
Further Details:      
 
Domain Number 5 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-37
Family Third domain of FERM 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105660   Gene: ENSMUSG00000022607   Transcript: ENSMUST00000110033
Sequence length 1092
Comment pep:known chromosome:NCBIM37:15:73035535:73253621:-1 gene:ENSMUSG00000022607 transcript:ENSMUST00000110033
Sequence
MAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSVSHCQHKVKKARRFLPLVFCSLEPPPTD
EISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGV
YLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIME
LCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCV
KLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGV
KPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTIL
EEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTN
HYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMG
QVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHI
YQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKLQPQEISPPPTANLDRS
NDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTH
REIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQ
ARLKMLGQTRPH
Download sequence
Identical sequences ENSMUSP00000105660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]