SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105815 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105815
Domain Number 1 Region: 24-266,306-381,543-577
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.2e-64
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.3e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105815   Gene: ENSMUSG00000027333   Transcript: ENSMUST00000110186
Sequence length 585
Comment pep:novel chromosome:NCBIM37:2:131317679:131350908:1 gene:ENSMUSG00000027333 transcript:ENSMUST00000110186
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHI
GGRVQSVRLGDTTFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRI
RDDPDDTEATKRLKLAMIQQYLKVESCESSSHSIDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPPHVIQLGKPVRCIHWDQASAHPRGPEIEPRGEGDHNHDTGEGGQSGENP
QQGRWDEDEPWPVVVECEDCEVIPADHVIVTVSLGVLKRQYTSFFRPCLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMERCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAHRSSTEQQPGHLLPSKCPEQSLDPSRGSIK
PMQVLFSGEATHRKYYSTTHGALLSGQREAARLIEMYRDLFQQGP
Download sequence
Identical sequences NP_001171304.1.92730 XP_006499350.1.92730 XP_006499351.1.92730 ENSMUSP00000105815 ENSMUSP00000105815 ENSMUSP00000105815 10090.ENSMUSP00000105815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]