SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106007 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106007
Domain Number 1 Region: 426-549
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.27e-24
Family Regulator of G-protein signaling, RGS 0.0022
Further Details:      
 
Domain Number 2 Region: 641-772
Classification Level Classification E-value
Superfamily PX domain 8.11e-20
Family PX domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106007   Gene: ENSMUSG00000038291   Transcript: ENSMUST00000110378
Sequence length 986
Comment pep:novel chromosome:NCBIM37:8:47118620:47237511:-1 gene:ENSMUSG00000038291 transcript:ENSMUST00000110378
Sequence
MHRDATDSSGARRGPTSAADACRAARGSADRPRTADGPGWGWRGPAAVAALAVLALCCLV
PGWGPAAGTGPGAVLLRLSLYLSCAAAALLLGTLVSLVCWSPRAQPPDFVSSWSRLAATV
RCPLRSPVYGNPQETAQGRRVVISHNMDRVLRDVFDYSYRDYILSWYGNLSRDDGQLYHL
LLDDFWEIVKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHACL
KDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQ
MLLRQLEYREQMSEHHKRAYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTIS
SFPQLKRHKGKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGAS
DEGEGPQSQKILQFEDIMTNPFYRERFGTYMERIDKRALVGFWESAEHLKNANKSEIPQL
VSEMYQNFFVESKEISVEKSLYKEIQQCLVGNRGIEVFSKIQADVSEVLRERYYPSFLVS
DLYEKLMREEEEEEPDAQLASEKDELGSGGEAGEEAVEGTSGVSDPASFAVIKLRELNEK
LEYKRQALSSIQNAPKPDKKIISKLKDEILLIEKECTALQLHMARTDWWCENLGLWRASI
TSAEVTEENGEQMPCYFVRVNLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQ
LPSLSKLPFKSIDHKFLGKSRNQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVIDVQ
GKKTSFSLSSFLEKLPRDFFSHQEEEIEEDSDLSDYGDDVDGKKDSLAEPCFMLIGEIFE
LRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAFWPNGKLAP
PTRIRSVAQSQETKQRAQQKLLENIPDTLQSLVGQQNARHGIIKIFKALQETKANKHLLY
VLMELLLTELCPELRAHLDQFKAGQV
Download sequence
Identical sequences E9Q1K0
10090.ENSMUSP00000106007 ENSMUSP00000106007 ENSMUSP00000106007 ENSMUSP00000035785 XP_006509305.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]