SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106188 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106188
Domain Number 1 Region: 3099-3408
Classification Level Classification E-value
Superfamily BEACH domain 3.79e-112
Family BEACH domain 0.000000128
Further Details:      
 
Domain Number 2 Region: 3526-3772
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.5e-34
Family WD40-repeat 0.0079
Further Details:      
 
Domain Number 3 Region: 2999-3103
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-20
Family PreBEACH PH-like domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000106188
Domain Number - Region: 399-652,704-726,813-831,1808-1860,2283-2372
Classification Level Classification E-value
Superfamily ARM repeat 0.000106
Family HspBP1 domain 0.092
Further Details:      
 
Domain Number - Region: 1531-1689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000419
Family Clostridium neurotoxins, the second last domain 0.06
Further Details:      
 
Domain Number - Region: 1895-2021,2301-2352,2413-2527,2684-2814
Classification Level Classification E-value
Superfamily ARM repeat 0.0222
Family GUN4-associated domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106188   Gene: ENSMUSG00000019726   Transcript: ENSMUST00000110559
Sequence length 3787
Comment pep:known chromosome:NCBIM37:13:13682676:13869707:1 gene:ENSMUSG00000019726 transcript:ENSMUST00000110559
Sequence
MSTDSNSLAREFLIDVNQLCNAVVQRAEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEQQATDFNLPLSSDIILTKEKNSSLQKSTQG
KLYLEGSAPSGQVSAKVNLFRKIRRQRKSTHRYSVRDARKTQLSTSDSEGNSDEKSTVVS
KHRRLHALPRFLTQSPKEGHLVAKPDPSATKEQVLSDTMSVENSREVILRQDSNGDILSE
PAALSILSNMNNSPFDLCHVLLSLLEKVCKFDIALNHNSSLALSVVPTLTEFLAGFGDCC
NQSDTLEGQLVSAGWTEEPVALVQRMLFRTVLHLMSVDVSTAEAMPESLRKNLTELLRAA
LKIRACLEKQPEPFSPRQKKTLQEVQEGFVFSKYRHRALLLPELLEGVLQLLISCLQSAA
SNPFYFSQAMDLVQEFIQHQGFNLFETAVLQMEWLLSRDGVPSEAAEHLKALINSVIKIM
STVKKVKSEQLHHSMCTRKRHRRCEYSHFMQHHRDLSGLLVSAFKNQLSKSPFEETAEGD
VQYPERCCCIAVCAHQCLRLLQQVSLSTTCVQILSGVHSVGICCCMDPKSVIVPLLHAFK
LPALKAFQQHILNVLSKLLLDQLGGAELSPRIKKAACNICTVDSDQLAKLGETLQGTLCG
AGPTSGLPSPSYRFQGILPSSGSEDLLWKWDALEAYQSFVFQEDRLHNIQIANHICNLIQ
KGNVVVQWKLYNYIFNPVLQRGVELVHHCQQLSIPSAQTHMCSQLKQYLPQEVLQIYLKT
LPVLLKSRVIRDLFLSCNGVNQIIELNYLDGIRSHSLKAFETLIVSLGEQQKDAAVLDVD
GLDIQQELPSLSVGPSLHKQQASSDSPCSLRKFYASLREPDPKKRKTIHQDVHINTINLF
LCVAFLCVSKEADSDRESANESEDTSGYDSTASEPLSHMLPCLSLENVVLPSPECLHHAA
DIWSMCRWIYMLNSVFQKQFHRLGGFQVCHELIFMIIQKLFRSHTEDQGRRQGEMSRNEN
QELIRISYPELTLKGDVSSATAPDLGFLRKSADSVRGFQSQPVLPTSAEQIVATESVPGE
RKAFMSQQSETSLQSIRLLESLLAICLHSARACQQKMELELPSQGLSVENILCELREHLS
QSKVAETELAKPLFDALLRVALGNHSADLGPGDAVTEKSHPSEEELLSQPGDFSEEAEDS
QCCSLKLLGEEEGYEADSESNPEDVDTQDDGVELNPEAEGFSGSIVSNNLLENLTHGEII
YPEICMLGLNLLSASKAKLDVLAHVFESFLKIVRQKEKNISLLIQQGTVKILLGGFLNIL
TQTNSDFQACQRVLVDLLVSLMSSRTCSEDLTLLLRIFLEKSPCTEILLLGIHKIVESDF
TMSPSQCLTFPFLHTPSLSNGVLSQKPPGILNSKALGLLRRARISRGKKEADRESFPYRL
LSSWHIAPIHLPLLGQNCWPHLSEGFSVSLWFNVEYIHESESAAERGKRVKKRNKPSVLE
DSSFEGAEGDRPEVTESINPGDRLIEDGCIHLISLGSKALMIQVWADPHSGTFIFRVCMD
SNDDTKAVSLAQVESQENIFFPSKWQHLVLTYIQHPQGKKNVHGEISIWVSGQRKTDVIL
DFVLPRKTSLSSDSNKTFCMIGHCLTSQEESLQLAGKWDLGNLLLFNGAKIGSQEAFFLY
ACGPNYTSIMPCKYGQPVIDYSKYINKDILRCDEIRDLFMTKKEVDVGLLIESLSVVYTT
CCPAQYTIYEPVIRLKGQVKTQPSQRPFSSKEAQSILLEPSQLKGLQPTECKAIQGILHE
IGGAGTFVFLFARVVELSSCEETQALALRVILSLIKYSQQRTQELENCNGLSMIHQVLVK
QKCIVGFHILKTLLEGCCGEEVIHVSEHGEFKLDVESHAIIQDVKLLQELLLDWKIWNKA
EQGVWETLLAALEVLIRVEHHQQQFNIKQLLNAHVVHHFLLTCQVLQEHREGQLTSMPRE
VCRSFVKIIAEVLGSPPDLELLTVIFNFLLAVHPPTNTYVCHNPTNFYFSLHIDGKIFQE
KVQSLAYLRHSSSGGQAFPSPGFLVISPSAFTAAPPEGTSSSNIVPQRMAAQMVRSRSLP
AFPTYLPLIRAQKLAASLGFSVDKLQNIADANPEKQNLLGRPYALKTSKEEAFISSCESA
KTVCEMEALLGAHASANGVSRGSPRFPRARVDHKDVGTEPRSDDDSPGDESYPRRPDNLK
GLASFQRSQSTVASLGLAFPSQNGSAVASRWPSLVDRNADDWENFTFSPAYEASYNRATS
THSVIEDCLIPICCGLYELLSGVLLVLPDAMLEDVMDRIIQADILLVLVNHPSPAIQQGV
IKLLHAYINRASKEQKDKFLKNRGFSLLANQLYLHRGTQELLECFVEMFFGRPIGLDEEF
DLEEVKHMELFQKWSVIPVLGLIETSLYDNVLLHNALLLLLQVLNSCSKVADMLLDNGLL
YVLCNTVAALNGLEKNIPVNEYKLLACDIQQLFIAVTIHACSSSGTQYFRVIEDLIVLLG
YLHNSKNKRTQNMALALQLRVLQAALEFIRSTANHDSESPVHSPSAHRHSVPPKRRSIAG
SRKFPLAQTESLLMKMRSVASDELHSMMQRRMSQEHPSQASEAELAQRLQRLTILAVNRI
IYQELNSDIIDILRTPENTSQSKTSVSQTEISEEDMHHEQPSVYNPFQKEMLTYLLDGFK
VCIGSSKTSVSKQQWTKILGSCKETLRDQLGRLLAHILSPTHTVQERKQILEIVHEPAHQ
DILRDCLSPSPQHGAKLVLYLSELIHNHQDELSEEEMDTAELLMNALKLCGHKCIPPSAP
SKPELIKIIREEQKKYESEESVSKGSWQKTVNNNQQSLFQRLDFKSKDISKIAADITQAV
SLSQGIERKKVIQHIRGMYKVDLSASRHWQECIQQLTHDRAVWYDPIYYPTSWQLDPTEG
PNRERRRLQRCYLTIPNKYLLRDRQKSEGVLRPPLSYLFEDKTHSSFSSTVKDKAASESI
RVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDAVESSSLQGELEPASFSWTYEEIKE
VHRRWWQLRDNAVEIFLTNGRTLLLAFDNNKVRDDVYQSILTNNLPNLLEYGNITALTNL
WYSGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYVSETLDLNDPSIYRNLSKPIA
VQYKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNSGTVLHFLVRMPPFT
KMFLAYQDQSFDIPDRTFHSTNTTWRLSSFESMTDVKELIPEFFYLPEFLVNREGFDFGV
RQNGERVNHVNLPPWARNDPRLFILIHRQALESDHVSQNICHWIDLVFGYKQKGKASVQA
INVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFHTAHASRPGAKLNIEGELP
AAVGLLVQFAFRETREPVKEVTHPSPLSWIKGLKWGEYVGSPSAPVPVVCFSQPHGERFG
SLQALPTRAICGLSRNFCLLMTYNKEQGVRSMNNTNIQWSAILSWGYADNILRLKSKQSE
PPINFIQSSQQHQVTSCAWVPDSCQLFTGSKCGVITAYTNRLTSSTPSEIEMESQMHLYG
HTEEITGLCVCKPYSVMISVSRDGTCIVWDLNRLCYVQSLAGHKSPVTAVSASETSGDIA
TVCDSAGGGSDLRLWTVNGDLVGHVHCREIICSVAFSNQPEGVSINVIAGGLENGIVRLW
STWDLKPVREITFPKSNKPIISLTFSCDGHHLYTANSEGTVIAWCRKDQQRVKLPMFYSF
LSSYAAG
Download sequence
Identical sequences G5E8Q0
NP_034878.2.92730 10090.ENSMUSP00000106188 ENSMUSP00000106188 ENSMUSP00000106188 ENSMUSP00000106188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]