SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106539 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106539
Domain Number 1 Region: 240-441
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-51
Family DBL homology domain (DH-domain) 0.00000000658
Further Details:      
 
Domain Number 2 Region: 433-557
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-34
Family Pleckstrin-homology domain (PH domain) 0.0000157
Further Details:      
 
Domain Number 3 Region: 165-236
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-25
Family SH3-domain 0.0000434
Further Details:      
 
Domain Number 4 Region: 2-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.15e-25
Family Calponin-homology domain, CH-domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000106539
Domain Number - Region: 798-854
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0222
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106539   Gene: ENSMUSG00000031511   Transcript: ENSMUST00000110914
Sequence length 862
Comment pep:known chromosome:NCBIM37:8:11728252:11835213:1 gene:ENSMUSG00000031511 transcript:ENSMUST00000110914
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEVFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RNESECLSNIREFLRACGASLRLETFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDS
VCARPSSHRIKSFDSLGSQSSHSRTSKLLQSQYRSLDMTDNTNSQLVVRAKFNFQQTNED
ELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPSEKPVSPKSGTLKSPPKG
FDTTAINKSYYNVVLQNILETEHEYSKELQSVLSTYLRPLQTSDKLSSANTSYLMGNLEE
ISSFQQVLVQSLEECTKSPEAQQRVGGCFLSLMPQMRTLYLAYCANHPSAVSVLTEHSED
LGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAF
KNLSAQCQEVRKRKELELQILTEPIRSWEGDDIKTLGSVTYMSQVTIQCAGSEEKNERYL
LLFPNLLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCT
SQQDLHEWVEHLQKQTKVTSVSNPTIKPHSVPSHTLPSHPLTPSSKHADSKPVALTPAYH
TLPHPSHHGTPHTTISWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMK
KLLPKRKPERKPSDEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMH
NHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASRSRKESAPQV
LLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKD
LEKLVRKVLKNMNDPAWDETNL
Download sequence
Identical sequences Q9ES28
XP_006508904.2.92730 ENSMUSP00000106539 10090.ENSMUSP00000106539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]