SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106746 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106746
Domain Number 1 Region: 56-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-80
Family Protein kinases, catalytic subunit 0.00000192
Further Details:      
 
Domain Number 2 Region: 1004-1066
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 
Domain Number 3 Region: 1082-1202
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000267
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000106746
Domain Number - Region: 1234-1380,1430-1486
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000157
Family Tricorn protease domain 2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106746   Gene: ENSMUSG00000026490   Transcript: ENSMUST00000111117
Sequence length 1732
Comment pep:novel chromosome:NCBIM37:1:181890716:182095734:1 gene:ENSMUSG00000026490 transcript:ENSMUST00000111117
Sequence
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPTSLDLDVSVQRTLDNNLATEAYERRIKRLEQEKLELTRKLQESTQTVQALQYSTVDGP
LTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKASEKQIKTL
QQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV
RDKEEEVDLVMQKAESLRQELRRAERAKKELEVHTEALIAEASKDKKLREQSEHYSKQLE
NELEGLKQKQISYSPGICSIEHQQEITKLKTDLEKKSIFYEEEISKREGIHASEIKNLKK
ELHDSEGQQLALNKEILVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLLTEENKKLT
SELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL
NKVKASNILTECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTP
TDALDQFERSPSCTPASKGRRIADCAPLPAHTPTLRKKGCPASTGFPPKRKTHQFFVKSF
TAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTVCPVPPEQTKGPLGIDPQKG
VGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPTSVISQVIDMRDEE
FSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSNKCSILMLADSENERSKWVGVLSELH
KILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIV
RVGDNKKIHQIELIPSDQLVAVISGRNRHVRLFPMSALDGRETDFYKLAETKGCQTIAAG
KVRHGALSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAIFSEHLCVGFQSGF
LRYPLNGEGGPCNMLHSNDHTLSFISHQPMDALCAVEISNKEYLLCFNSIGIYTDCQGRR
SRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNTEGSLNL
LGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREM
LRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKS
RPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYNTKRQPMPSPSEGSLSSGGMDQGSD
APARDYDGEDSDSPRHSTASNSSNLSSPPSPISPQKTKSLSLESTDRGSWDP
Download sequence
Identical sequences E9PVY0
10090.ENSMUSP00000106746 NP_001028457.1.92730 ENSMUSP00000106746 ENSMUSP00000106746 ENSMUSP00000095059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]