SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107580 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107580
Domain Number 1 Region: 651-938
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-57
Family Protein kinases, catalytic subunit 0.0000108
Further Details:      
 
Domain Number 2 Region: 389-457
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107580   Gene: ENSMUSG00000061578   Transcript: ENSMUST00000111949
Sequence length 959
Comment pep:known chromosome:NCBIM37:5:117864838:118213336:1 gene:ENSMUSG00000061578 transcript:ENSMUST00000111949
Sequence
MDEENMTKSEEQQPLSLQKALQQCELVQNMIDLSISNLEGLRTKCAASNDLTQKEIRTLE
SKLVKYFSRQLSCKKKVALQERNAELDGFPQLRHWFRIVDVRKEVLEEISPDQLSLEDLL
EMTDEQVCETVEKYGANQEECARLNASLSCLRNVHKSGGNLSKQDWIIQWPTTEPGQESN
PVCPPEPSPWIRTHLSQSPRVQTKCPQHFCPTSPTPGTPVYTQVDRLTVDAYPNLCPPPP
PLESGHRSLPPSPRQRHVVRTPPRTPNIVTTVTPPGTPPMRRKNKLKPPGTPPPSSRKLI
HLIPGFTALHRSKSHEFQLGNRVDEANTPKAKKKSKPLNLKIHSGVGSCENIPAQQRSPL
LSERSLRSFFVGHGPFLPSTPPVHTEANFSANTLSVPRWSPQIPRRDLGNSIKHRFSTKY
WMSQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIHRGDSLCCFYPTDPARLV
RTESVPCDINNPVRKPARYSDLHISQTLPKTNKINKDHIPVPYQPDSSSNPSSTTSSTPS
SPAPPLPPSATPPSPLHPSPQCPRQKKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQ
VILHPVTSNTILEGNPLLQIEVEPTSENEESHNEAEESEDEFEEMNLSLLSARSFPRKAS
QTSIFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQLKAFKRE
VMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEI
VKGMGYLHAKGILHKDLKSKNVFYDNGKVVITDFGLFSISGVLQAGRRDDKLRIQNGWLC
HLAPEIIRQLSPDTEEDKLPFSKHSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGM
KPNLSQIGMGKEISDILLFCWAFEQEERPTFTKLMDMLEKLPKRNRRLSHPGHFWKSAE
Download sequence
Identical sequences Q3UVC0
ENSMUSP00000107580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]