SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107777 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107777
Domain Number 1 Region: 292-419
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 421-525
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-24
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 63-158
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-16
Family PDZ domain 0.015
Further Details:      
 
Domain Number 4 Region: 203-286
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000413
Family Ras-binding domain, RBD 0.077
Further Details:      
 
Domain Number 5 Region: 36-67
Classification Level Classification E-value
Superfamily WW domain 0.000000475
Family WW domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107777   Gene: ENSMUSG00000049176   Transcript: ENSMUST00000112149
Sequence length 1320
Comment pep:known chromosome:NCBIM37:X:163909241:164561262:-1 gene:ENSMUSG00000049176 transcript:ENSMUST00000112149
Sequence
MDVFSFVKIPKLSSHRTKSSGWPPPSGTWGLNQVPPYGWEMMTNRDGRDYFINHMTQAIP
FDDPRFDSCQIIPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQI
VMINDEAVSAAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRF
SEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIK
GIEHFSLMLEQRIEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRR
DPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEW
GLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYG
GRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEEESLV
RVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAGTQDTGSEN
KGKHNLLGPDWNCMPQMTTFIGEGEQEAQITYIDSKQKTVEMTDSTLCPKEHRHLYIDNS
YSSDELNQPLTQPGDAPCEADYRSLAQRSLLTLSGPDTLKKAQESPRGAKVSFIFGDLAL
DDGMSPPTIGYERMLEENPEMLEKQRNLYISSANDMKNLDLTPDTDSIQFVANSVYANIG
DVKNFEAPEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILDLSGSSDDI
IDLTTLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDTQSQATSFHEDKEQGSSL
QNEEIPVSLIDAVPTSAEGKCEKGLDPAVVSTLEALEALSEEQQKSENSGVAILRAYSPE
SSSDSGNETNSSEMTEGSELAAAQKQSESLSRMFLATHEGYHPLAEEQTEFPTSKAPSVG
LPPKSSHGLAARPATDLPPKVVPSKQILHSDHMEMEPETMETKSVTDYFSKLHMGSVAYS
CTSKRKSKLPEGEGKSPLSGNIPGKKQQGTKIAEIEEDTKGKAGTVSSRDNPHLSTFNLE
RTAFRKDSQRWYVASDGGVVEKSGMEAPAMKVFPRGPGLGNREAEGKEDGTVEGGADDAS
VLGQGDRFLTDMACVASAKDLDNPEDTDSPSCDHATKLSEAEDNVARLCDYHLAKRMSSL
QSEGHFSLQSSQGSSVDTGCGPGSSSSACATPVESPLCPSMGKHMIPDASGKGGRYISPE
ERAPGHPNHGATFEELHPQTEGMCPRMTVPALHTAINADPLFGTLRDGCHRLPKIKETTV
Download sequence
Identical sequences A2AFR3
ENSMUSP00000107773 ENSMUSP00000107777 ENSMUSP00000107777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]