SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108250 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108250
Domain Number 1 Region: 509-803
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-75
Family Protein kinases, catalytic subunit 0.0000123
Further Details:      
 
Domain Number 2 Region: 137-495
Classification Level Classification E-value
Superfamily ARM repeat 1.08e-23
Family Armadillo repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108250   Gene: ENSMUSG00000042567   Transcript: ENSMUST00000112631
Sequence length 1111
Comment pep:novel chromosome:NCBIM37:14:15653279:15833718:1 gene:ENSMUSG00000042567 transcript:ENSMUST00000112631
Sequence
MPDQDTKAKSTEKTADKQQGTTTRDYSDLKRLRCLLNVQSSKQQLPAINFDSAQNNMTKS
EPTIRTGGHRARGQWHESTEAVELENFSINYKNERNFSKHPQHQLFQEIFTALVRNRLIC
REWVNRAPSIHFLRVLICLRLLMRDPCYQEILHKLGGIEDLAQYMEIVANEYLGYAEEQH
CVDKLVNMTYIFQKLAAVKDQREWVTASGAHKTLVSLLGARDTTVLLGALLALASLAESS
ECREKISELNVVENLLMILHEYDLLSKRLTAELLRLLCAEPQIKEQVKLYEGIPILLSLL
HSDHLKLLWSVIWILVQVCEDPETSVEIRIWGGIKQLLHILQGDRNFVSDRSSIGSLSSA
NAAGRIQQLHLSEDLSPGEIEENTVSLQAACCAALTELALNDTNAHQVVQENGVYTIAKL
ILPNKQSNAAQTNLLQCYAFRTLRFLFSMERNRPLFKRLFPTDLFETFIDIGHYVRDIGA
YKDLVSQLNLLLEDELKQIAENIESINQKKAPLKYIGDYAVLDHLGSGAFGCVYKVRKRS
GQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVSELTIIKEQLYHPNVVRYYKTFLENDRL
YIVMELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNN
IMLGDKDKVTVTDFGLAKQKQESSKLTSMVGTILYSCPEVLKSEPYGEKADVWAAGCILY
QMATLSPPFCSTNMLSLATKIVEAVYEPVPEGIYSEKVTDTIRRCLTPDAEARPDIVEVS
SMISDVMMKYLDRLSTSQLALERKLERERRRTQRYFMEANRNAVTCHHELALLSQETFEK
ASLSSSSSGAASLKSELSESAELPGEGCHIPCGKEEDRVCEEVLSEDNFQLESVEKDLYS
ELDDELDVSDNCSSSSSSPLKESTFSILKRSFSASGRERHSQARDFIAGLGSRPRPGPQM
STFVVESASAGIAVSQRKVRQICDPIQQILIQLHKVIYITQLPPALHHDLKRRVIERFKK
SLFSQQSNPCNLKSEIKKLSQGSPEPIELNFLTSDYHSLRHSRAANNWSPSDPTGSPSSF
EVEEGVTYEQMQTVIEEVLEESGYYNFTTKR
Download sequence
Identical sequences Q3UGM2
ENSMUSP00000108250 ENSMUSP00000108250 10090.ENSMUSP00000108250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]