SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108612 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108612
Domain Number 1 Region: 508-686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-45
Family SPRY domain 0.0026
Further Details:      
 
Domain Number 2 Region: 167-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.14e-16
Family B-box zinc-binding domain 0.0000157
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000166
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 4 Region: 375-423,465-513
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000266
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000108612
Domain Number - Region: 106-160
Classification Level Classification E-value
Superfamily RING/U-box 0.00406
Family ZZ domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108612   Gene: ENSMUSG00000000266   Transcript: ENSMUST00000112988
Sequence length 715
Comment pep:novel chromosome:NCBIM37:X:137199611:137298534:1 gene:ENSMUSG00000000266 transcript:ENSMUST00000112988
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEPITAFQCPTCR
YVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPSSAMSSERIACQ
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVSDTHLRGITCLDHEN
EKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVA
NCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMATASSQVLIPDINFNDAFE
NFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTI
FTGQANFISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGKYNSVDSWMIVPNIKQNHYTV
HGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDE
SSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGK
NASSWVFSRCNSNFVVRHNNKEMLVDVPPQLKRLGVLLDYDNNMLSFYDPANSLHLHTFD
VTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences B1AVF5
ENSMUSP00000108612 ENSMUSP00000108612 ENSMUSP00000108617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]