SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109030 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109030
Domain Number 1 Region: 672-951
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-84
Family Protein kinases, catalytic subunit 0.000000000777
Further Details:      
 
Domain Number 2 Region: 62-233
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-70
Family Ephrin receptor ligand binding domain 0.00000151
Further Details:      
 
Domain Number 3 Region: 359-562
Classification Level Classification E-value
Superfamily Fibronectin type III 1.81e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 970-1036
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.27e-22
Family SAM (sterile alpha motif) domain 0.00054
Further Details:      
 
Domain Number 5 Region: 290-361,397-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000222
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109030   Gene: ENSMUSG00000029245   Transcript: ENSMUST00000113403
Sequence length 1040
Comment pep:known chromosome:NCBIM37:5:84486816:84845831:-1 gene:ENSMUSG00000029245 transcript:ENSMUST00000113403
Sequence
MRGSGPRGAGHRRTQGRGGGDDTPRVPASLAGCYSAPLKGPLWTCLLLCAALRTLLASPS
NEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWI
SNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDENGRSIKENQYIKIDTIA
ADESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVR
HLAIFPDTITGADSSQLLEVSGSCVNHSVTDDPPKMHCSAEGEWLVPIGKCMCKAGYEEK
NGTCQVCRPGFFKASPHSQTCSKCPPHSYTHEEASTSCVCEKDYFRKDSDPPTMACTRPP
SAPRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPQQ
IGLKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGTRQYVSVNVTTNQAAPSPVTNVKKG
KIAKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETSITAEGLKPASVYVF
QIRARTAAGYGVFSRRFEFETTPVSVAASNDQSQIPIIAVSVTVGVILLAVMIGFLLSGS
CCDCGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYE
DPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQ
RRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQL
VGMLRGIAAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRG
GKIPIRWTAPEAIAFRKFTSSSDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRL
PSPMDCPAALYQLMLDCWQKDRNSRPKFDEIVNMLDKLIRNPSSLKTLVNASSRVSTLLA
EHGSLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQK
KIMSSLQEMKVQMVNGMVPV
Download sequence
Identical sequences E9PUQ0
ENSMUSP00000109030 10090.ENSMUSP00000109030 XP_006534832.1.92730 ENSMUSP00000109025 ENSMUSP00000109030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]