SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109234 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109234
Domain Number 1 Region: 254-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-80
Family Protein kinases, catalytic subunit 0.0000000152
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 1.3e-33
Family SH2 domain 0.0000242
Further Details:      
 
Domain Number 3 Region: 74-141
Classification Level Classification E-value
Superfamily SH3-domain 5.71e-17
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109234   Gene: ENSMUSG00000054892   Transcript: ENSMUST00000113604
Sequence length 527
Comment pep:known chromosome:NCBIM37:5:73087217:73144012:-1 gene:ENSMUSG00000054892 transcript:ENSMUST00000113604
Sequence
MILSSYSSFQSVLCCCCCRCSVQKRQVRTQISLSREEELSEKHSQRQRPWFAKLMGKTQS
NRGGVQPSKRKPLPPLPQEPPDERIQVKALYDFLPREPGNLALKRAEEYLILERCDPHWW
KARDRFGNEGLIPSNYVTENRLANLEIYEWYHKNITRNQTERLLRQEAKEGAFIVRDSRH
LGSYTISVFTRARRHTQSSIKHYQIKKNDSGQWYITERHLFPSVPELIQYHQYNAAGLIS
RLRYPIGLLGSCLPATSGFSYEKWEIDPSELAFVKEIGSGQFGVVHLGEWRAHIPVAIKA
INEGSMSEEDFIEEAKVMMKLSHSRLVQLYGVCIQQKPLYIVTEFMENGCLLDYLRERKG
QLQKALLLSMCQDICEGMAYLERSCYIHRDLAARNCLVSSACVVKISDFGMARYVLDDEY
ISSSGAKFPVKWCPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
QGFRLYRPHLAPMTIYRVMYSCWHESPKGRPTFAELLQVLTEIAETW
Download sequence
Identical sequences P42682
ENSMUSP00000129397 ENSMUSP00000109234 NP_001116226.1.92730 ENSMUSP00000109234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]