SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109336 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109336
Domain Number 1 Region: 311-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-73
Family SPRY domain 0.00000247
Further Details:      
 
Domain Number 2 Region: 30-103
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-22
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 113-174
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.75e-17
Family B-box zinc-binding domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000109336
Domain Number - Region: 158-241
Classification Level Classification E-value
Superfamily OmpH-like 0.0654
Family OmpH-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109336   Gene: ENSMUSG00000045409   Transcript: ENSMUST00000113706
Sequence length 500
Comment pep:known chromosome:NCBIM37:17:36395818:36408378:-1 gene:ENSMUSG00000045409 transcript:ENSMUST00000113706
Sequence
ARHSGTRSREVIMAETSLLEAGTSAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNF
CKACITRWWEDLERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQTVKRKIRDESLCS
QHHEPLSLFCYEDQEAVCLICAISHTHRPHTVVPMDDATQEYKEKLQKCLEPLEQKLQEI
TCCKASEEKKPGELKRLVESRRQQILKEFEELHRRLDEEQQTLLSRLEEEEQDILQRLRE
NAAHLGDRRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEKCEKVKTMEVTSVSIELEKNF
SNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPQRFTF
YPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDK
YAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPG
IRAGRKNAAPLTIRPPTDWE
Download sequence
Identical sequences Q570Z1
ENSMUSP00000109336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]