SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109483 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109483
Domain Number 1 Region: 308-469
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-42
Family Dual specificity phosphatase-like 0.00068
Further Details:      
 
Domain Number 2 Region: 273-320
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000994
Family DEK C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109483   Gene: ENSMUSG00000034616   Transcript: ENSMUST00000113852
Sequence length 653
Comment pep:known chromosome:NCBIM37:19:4261668:4269172:-1 gene:ENSMUSG00000034616 transcript:ENSMUST00000113852
Sequence
MALVTVSRSPPASGHSTPVGPTQDRVVRRRGRLQRRQSFAVLRGAVLGLQDGGDSNVASE
ADSEPMEEPSGEEQPTEDQTDKGQGLQSPWKQVQKRHLHLMVELLRPQDDIRLAAQLEAA
RPPRLRYLLVVSTGEELSEEAILLGVDFPDSSSHSCTLGLVLPLWSDTQVYLDGDGGFSV
TSGGQSRIFKPVSIQTMWATLQVLHQACEVALGSGLVPGGSALAWATYYQEKLNSDQGCL
NEWMAMSDLESFRPPNAEPGQITTRASEQEKMEQAILAELWQVLDTSDLDSVTSKEIRQA
LELRLGCPLQQYRDFIDNQMLLLMAQQDRASRIFPHLYLGSEWNAANLEELQKNRVSHIL
NMAREIDNFFPERFTYYNVRVWDEESAQLLPHWKETHRFIEDARAQGTRVLVHCKMGVSR
SAATVLAYAMKQYGWDLEQALIHVQELRPIVRPNHGFLRQLRTYQGILTASRQSHVWEQK
VGVVSPEEPLAPEVSTPLPPLPPEPGGSGEVMVMGLEGSQETPKEELGLRPRINLRGVMR
SISLLEPSESESTPEAGGLPEVFSSDEEPLHPFSQLSRAKGGQRVRKGPWPALKSRQSVV
ALHSAALVASRTRAFQEQGQGQEQSEPGMSSTPRLRKVMRQASVDDSREEDKA
Download sequence
Identical sequences ENSMUSP00000109483 ENSMUSP00000109483 ENSMUSP00000109483 10090.ENSMUSP00000109483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]