SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110807 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110807
Domain Number 1 Region: 60-177
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000000981
Family Mannose 6-phosphate receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110807   Gene: ENSMUSG00000035521   Transcript: ENSMUST00000115154
Sequence length 340
Comment pep:known chromosome:NCBIM37:17:25371265:25377061:-1 gene:ENSMUSG00000035521 transcript:ENSMUST00000115154
Sequence
MAGRLAGFLMLLGLASQGPAPACAGKMKVVEEPNTFGLNNPFLPQASRLQPKREPSAVSG
PLHLFRLAGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIINNTFKG
MWMTDGDSCHSRSRQSKPLRLSSQVELTCGKINRLAHVSEPSTCVYALTFETPLVCHPHS
LLGRPLGRGGSREGGEVGDCNVWLLLSVVYPTLSEALQQRWDQVEQDLADELITPQGYEK
LLRVLFEDAGYLKVPGETHPTQLAGGSKGLGLETLDNCRKAHAELSQEVQRLTSLLQQHG
IPHTQPTETTHSQHLGQQLPIGAIAAEHLRSDPGLRGNIL
Download sequence
Identical sequences ENSMUSP00000110807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]