SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110929 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110929
Domain Number 1 Region: 577-711,788-960
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-79
Family Protein kinases, catalytic subunit 0.0000000213
Further Details:      
 
Domain Number 2 Region: 225-309
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000533
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 3 Region: 334-419
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000497
Family I set domains 0.064
Further Details:      
 
Domain Number 4 Region: 43-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000337
Family I set domains 0.033
Further Details:      
 
Domain Number 5 Region: 421-531
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000432
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110929   Gene: ENSMUSG00000024620   Transcript: ENSMUST00000115274
Sequence length 1103
Comment pep:known chromosome:NCBIM37:18:61204854:61244710:1 gene:ENSMUSG00000024620 transcript:ENSMUST00000115274
Sequence
MEDTMGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGS
APVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIY
IFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQR
GFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIV
MGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSV
NDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTL
GDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPV
RVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKSRCPRKLSPTPLGNSSKEESQL
ETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVIS
AILALVVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELP
RDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMS
HLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELY
SNALPVGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYD
NYVPSAPERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICE
GKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEI
FTLGGTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVL
LLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNE
SDNDYIIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPE
AQLEQPQDSGCPGPLAEAEDSFL
Download sequence
Identical sequences E9QN12
ENSMUSP00000110929 10090.ENSMUSP00000110929 NYSGRC-IgSF-P05622 ENSMUSP00000110929 ENSMUSP00000110929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]