SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110987 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110987
Domain Number 1 Region: 405-513
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.8e-19
Family Mannose 6-phosphate receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 210-259
Classification Level Classification E-value
Superfamily EF-hand 0.0000144
Family Polcalcin 0.067
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000110987
Domain Number - Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000101
Family LDL receptor-like module 0.0062
Further Details:      
 
Domain Number - Region: 32-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000144
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 126-216
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0973
Family FCH domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110987   Gene: ENSMUSG00000003402   Transcript: ENSMUST00000115331
Sequence length 528
Comment pep:known chromosome:NCBIM37:9:21807479:21818663:1 gene:ENSMUSG00000003402 transcript:ENSMUST00000115331
Sequence
MLLLLLLLLPLCWAVEVKRPRGVSLSNHHFYEESKPFTCLDGTATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKG
RKEKESLQQLAEVTREGFRLKKILIEEWKTAREEKQSKLLELQAGKKSLEDQVETLRAAK
EEAERPEKEAKDQHRKLWEEQQAAAKARREQERAASAFQELDDNMDGMVSLAELQTHPEL
DTDGDGALSEEEAQALLSGDTQTDTTSFYDRVWAAIRDKYRSEVPPTDIPVPEETEPKEE
KPPVLPPTEEEEEEEEEPEEEEEEEEEEEVQGEQPKEAPPPLQPPQPPSPTEDEKMPPYD
EETQAIIDAAQEARSKFEEVERSLKEMEESIRSLEQEISFDFGPSGEFAYLYSQCYELTT
NEYVYRLCPFKLVSQKPKHGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGPNRSTT
VRLLCGKETVVTSTTEPSRCEYLMELMTPAACPEPPPEAPSDGDHDEL
Download sequence
Identical sequences NP_001280579.1.92730 XP_006510158.1.92730 XP_006510159.1.92730 ENSMUSP00000110987 ENSMUSP00000110987 ENSMUSP00000110987 10090.ENSMUSP00000110987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]