SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000111316 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000111316
Domain Number 1 Region: 269-653
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-163
Family Myotubularin-like phosphatases 0.00000000000052
Further Details:      
 
Domain Number 2 Region: 143-266
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-43
Family GRAM domain 0.000000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000111316   Gene: ENSMUSG00000031918   Transcript: ENSMUST00000115652
Sequence length 711
Comment pep:known chromosome:NCBIM37:9:13553561:13610925:1 gene:ENSMUSG00000031918 transcript:ENSMUST00000115652
Sequence
MRIAPLCSATGPDSRQPPRAVQAGGTWPLPVSEPAWRGADRGCGPVRSSLCISRRRPRRA
QRPPVSRAMEKSSSCESLGAQLPAARLPSEDSLSSASTSHSENSVHTKSASAISSDSIST
SADNFSPDLRVLREANKLAEMEEPALLPGENIKDMAKDVTYICPFTGAVRGTLTVTSYRL
YFKSMERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTR
RSIFENLMKYAFPVSNGLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINE
RYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATVTRCSQPMVGVS
GKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLD
IHNIHVMRESLRKLKEIVYPTIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTS
VVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHA
DADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKEN
LPKKTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEP
IHSRYKELLAKRAELQRKVEELQREISNRSTSSSERASSPAQCVTPVQTVV
Download sequence
Identical sequences XP_006510740.1.92730 ENSMUSP00000111316 10090.ENSMUSP00000111316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]