SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112147 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112147
Domain Number 1 Region: 89-410
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-85
Family Protein kinases, catalytic subunit 0.00000275
Further Details:      
 
Domain Number 2 Region: 977-1045
Classification Level Classification E-value
Superfamily G protein-binding domain 1.86e-25
Family RhoA-binding domain 0.0000497
Further Details:      
 
Domain Number 3 Region: 1207-1296,1373-1407
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000479
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 4 Region: 1315-1364
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000436
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000112147
Domain Number - Region: 437-544
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00248
Family Myosin rod fragments 0.002
Further Details:      
 
Domain Number - Region: 553-656
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number - Region: 821-916
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112147   Gene: ENSMUSG00000020580   Transcript: ENSMUST00000116446
Sequence length 1445
Comment pep:known chromosome:NCBIM37:12:16901784:16995080:1 gene:ENSMUSG00000020580 transcript:ENSMUST00000116446
Sequence
MSRPPPTGKMPGAPETAPGDGAGAGRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDTEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYFRENL
LLSDSPPCRENDAIQTRKSEESQEIQKKLYALEEHLSSEVQAKEELEQKCKSINTRLEKT
AKELEEEITLRKSVESTLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQSSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKTGKA
LLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNELLK
QKDVLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVNTLKMSEKQIKQENNHLMEMKMN
LEKQNTELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEENEEKTKLCKELQQK
KQDLQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDTTIASLEETNRTLTSDVANLANEKEELNNKLKDSQEQLSKLKDEEMSAAAIKAQF
EKQLLNERTLKTQAVNKLAEIMNRKEPVKRGSDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGMDSSSIGSGPG
DAEPDDGFPVHITQSHTMESMSFTYQRSSTSLSIATKPSSSHTLLDFDSEEDSLPYLPSS
SEPISTESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDID
KLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEPEFPVEPVGEKSNYICHKGHEF
IPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISS
AKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLA
PNKPS
Download sequence
Identical sequences ENSMUSP00000112147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]