SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112675 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112675
Domain Number 1 Region: 9-291
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.8e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112675   Gene: ENSMUSG00000024539   Transcript: ENSMUST00000122412
Sequence length 406
Comment pep:known chromosome:NCBIM37:18:67830866:67884249:-1 gene:ENSMUSG00000024539 transcript:ENSMUST00000122412
Sequence
MSATIEREFEELDAQCRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQSTENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKES
VKCAQYWPTDDREMVFKETGFSVKLLSEDVKSYYTVHLLQLENINTGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGCLTPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGE
DVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTKGDSNIQKRWKELSKEDLSPI
CDHSQNRVMVEKYNGKRIGSEDEKLTGLPSKVQDTVEESSESILRKRIREDRKATTAQKV
QQMKQRLNETERKRKRWLYWQPILTKMGFVSVILVGALVGWTLLFH
Download sequence
Identical sequences Q06180
10090.ENSMUSP00000112675 NP_001120649.1.92730 ENSMUSP00000113182 ENSMUSP00000112675 ENSMUSP00000112675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]