SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112688 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112688
Domain Number 1 Region: 11-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000229
Family SAM (sterile alpha motif) domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000112688
Domain Number - Region: 718-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.013
Family RecA protein-like (ATPase-domain) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112688   Gene: ENSMUSG00000047735   Transcript: ENSMUST00000120087
Sequence length 1579
Comment pep:novel chromosome:NCBIM37:6:3322257:3349571:-1 gene:ENSMUSG00000047735 transcript:ENSMUST00000120087
Sequence
MSGQVTQPKLIKDWTKEHVRKWVTEDLNIVEKYAQILFKEEVTGMVLQELTEEDLREMGL
PRGPALLIKRMYNKLISSPESHNQDSRELNDKKLSTKEQQTKTKNEEENSVSSNSDHGLR
ETGQNEEQEPSLTKENMLGDVVTKDMEDNKPKPEQMSCTPYPFDSFCDVKQYIEHSILRV
AETGPLNLIDPIHEFKAFTNTKKATEEDIKMKFSNETFRFAAACMNSRTNGTIHFGVKDK
PHGEIVGVQVTSKDIFVNHFNTMITKYFEDSEISEARACIREPRFVEVLLQNNTQSNRFV
IEVDVIPRHSICQEKYFYIMMQSSTGKTWKQSKDTSLFVREGASSKNILGNPNQRDREFK
KFLEDLKMWTASRKAAEEELRMVTKKESEGLKLSKLLTRHQGSLDESYYDWYILVTNTCA
PTQLEHLEFIKEMKLFAVLDFDPYSHIKGVVKAYRESRIANLHLPSHYEEKTTIAEKIST
LKLYEQPSWIFCNGRVDLSCQPLEPHLWQRDRASGVRRLISFLTDENIIVKGKVLVVFLL
LSPIENQKDPLIETFCAFYQVFNGMDNMLCICVNSAIYQQWSDLLQVRLEIKDDLAKHSI
STLNIELVNNTILKLKSVIQSSRRFLPSCGSSSVILEKMDEDIMSALEILCENECKDTDI
EKDESQFLEFKKSREEHFYRGGRVSWWNFYFSSENYSSAFVKRDSFEELTTLIQQCADSP
KPVFVKVINLYHHPGCGGTTLAMHVLWDLKQKFRCAVLKNKATDFVEIGEQVSKLMSYKA
TSHEDFIPVLLLVDDFEEQENAYILQNAINAFIAEKGLRYEKTLVIILNCMRSQNPDESA
KLANSISLKYQLSPKEQRAFEAKLQEIEKEHKNCENFYSFMILKGNFDTTYIKNVVKNTL
KDLDAKSRRAQLISYLALLNSYVTDSTISVSQCEIFLGITYTKKYGKPETVEKNMGTYST
LLIRTEVSDYGRYTGIRIIHPLIATHCLKELEMSYRMDKCQIALNMLEENVLYDSGLGRD
KFKYDVQTLLLTRQRKEHGAETDTLFSPLIEELQNEETEKVLIAGSDRFPQNAFICQALA
RHFYIKEKNFSTALVWANLAKRKAPKNSYISDTLGQVYKSELKQWLGKNKTCGNISVDDL
AYFLEVAEKASKAFKESQNQSDSKDYGTEAWSPQNSQRRYDTFNTAGFFGEIEVGLDTIQ
LLQLTPLFHKENEISKESMAEFLSGKGTILSDPKGEYCVVLSKFTSLLQNLHSDLERCFH
FFGDYMGFLKPRNTPKELTELLLSKKVSRCFKKYVELFCHLDTNLVQGKEDLLLQKENCR
KRIQAWRADTFSGLLEYLNPNHKEANNIENIVGNYTFLLQDILNKQLSKVLTKDIQNFIL
ANIILSCLKPSSKYILPFSTLKKKLREVLQIVGLTHSYPDPYFLACLLFWPENKELDEDS
TLIEKYVSSLNRSFRRQYKHMCRSRQPSTLFYLGQKKGLNSLVHKAEIERYFSEVQDSNS
FWHSGVVWEKREVKDLLRLLDGQAEGKLISLEYGTEAKIKIPVTSVYSAPLRSGRNIERV
SFYLGFSIEGPLAYGIKVI
Download sequence
Identical sequences E9PX59
10090.ENSMUSP00000112688 ENSMUSP00000112688 ENSMUSP00000112688 ENSMUSP00000112688 NP_034286.2.92730 XP_006505089.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]