SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113252 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113252
Domain Number 1 Region: 43-106
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0026
Further Details:      
 
Domain Number 2 Region: 209-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000698
Family Ras-binding domain, RBD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113252   Gene: ENSMUSG00000010067   Transcript: ENSMUST00000122225
Sequence length 344
Comment pep:novel chromosome:NCBIM37:9:107453898:107464594:1 gene:ENSMUSG00000010067 transcript:ENSMUST00000122225
Sequence
MSAEPELIELRELAPSGRIGPGRTRLERANALRIAPGTTRNPSQQHVPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAPLSADCKFTCHYRCRALVCLDCCGPRDLGWDSALERD
TNVDEAVERETPDLSQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVV
DDPRKFALFERTERHGQVYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG
Download sequence
Identical sequences B0QZV7
ENSMUSP00000113252 ENSMUSP00000113252 10090.ENSMUSP00000113252 ENSMUSP00000091301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]