SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113395 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113395
Domain Number 1 Region: 578-864
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-79
Family Protein kinases, catalytic subunit 0.0000247
Further Details:      
 
Domain Number 2 Region: 417-532
Classification Level Classification E-value
Superfamily PH domain-like 4.59e-35
Family Pleckstrin-homology domain (PH domain) 0.0000256
Further Details:      
 
Domain Number 3 Region: 130-205
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 257-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113395   Gene: ENSMUSG00000024070   Transcript: ENSMUST00000119284
Sequence length 890
Comment pep:novel chromosome:NCBIM37:17:79349889:79420156:-1 gene:ENSMUSG00000024070 transcript:ENSMUST00000119284
Sequence
MSANNSPPSAQKSVFPATVSAVLPAPSPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTV
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPECVPLLSEES
HTHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPCSVGTDADMPMDIDSSDVNSDGSRGLDDS
EEPSPPEDKMFFLDPTDLDVERDEETVKTISPSTSNNIPLMRVVQSIKHTKRRSSTVVKE
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRVSSPQDFTSISQG
SNPHCFEIITDTVVYFVGENNGSSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLATSISVSNCQVQENVDISSVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISSEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLEYPKHFIMAPNPDDMEEDP
Download sequence
Identical sequences Q5FWX6
ENSMUSP00000113395 ENSMUSP00000113395 NP_001164475.1.92730 ENSMUSP00000112775 10090.ENSMUSP00000113395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]