SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113398 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113398
Domain Number 1 Region: 239-363
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.63e-45
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113398   Gene: ENSMUSG00000002459   Transcript: ENSMUST00000118000
Sequence length 372
Comment pep:known chromosome:NCBIM37:1:4899657:5060366:-1 gene:ENSMUSG00000002459 transcript:ENSMUST00000118000
Sequence
MPSLSQENQGYLEEHLTRQAAQAQLLPLFRAEKDYNPSIDQDTEDKEGSQAVTGVKLPDS
TGSTHFATFLACSPAVLVSSAATPSRGLPGRRDFPSQPSSWPTAWLSPEPHRLLFLLVAS
MALPGRRPRGRLLKLASPNSEPRGEDACTEKSSPESPEGSERTEMRMRQMCGGSETQGPA
PSQQGGRGSNACCFCWCCCCTCSCLTVRNQEDQRPQRASHEIRTDIPACEESPTPTLEEV
CAWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYE
DYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKD
LLTSLAEKTVEA
Download sequence
Identical sequences E9Q720
ENSMUSP00000113324 ENSMUSP00000113398 ENSMUSP00000113398 10090.ENSMUSP00000113398 NP_001171266.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]