SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113726 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113726
Domain Number 1 Region: 65-372,475-513
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.97e-65
Family FAD-linked reductases, N-terminal domain 0.0000405
Further Details:      
 
Domain Number 2 Region: 353-459
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.7e-24
Family L-aminoacid/polyamine oxidase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113726   Gene: ENSMUSG00000074141   Transcript: ENSMUST00000118125
Sequence length 638
Comment pep:known chromosome:NCBIM37:7:52071740:52096174:1 gene:ENSMUSG00000074141 transcript:ENSMUST00000118125
Sequence
MGARRAPQRPPCTLRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLLKVVTLGL
NRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEKTGWIGELG
AMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPEKLGYNLNNR
ERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSRPAVQLLGDVM
SEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALLLNAPVVSITQG
RNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEALRALHYVAASKV
FLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPAQGEGSLLLASYTWSDAAAPFAGLSTDQT
LRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLYGREAEDYDWSAPFG
RIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMMEHAYAEANYLDQYPEG
ERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPELQGHVFVETVPQEKGHA
HQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS
Download sequence
Identical sequences D3Z4E0
10090.ENSMUSP00000103522 ENSMUSP00000033015 ENSMUSP00000113726 ENSMUSP00000113726 NP_001164495.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]