SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114467 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114467
Domain Number 1 Region: 14-55,124-323
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.83e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.089
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000114467
Domain Number - Region: 289-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000971
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114467   Gene: ENSMUSG00000074063   Transcript: ENSMUST00000152420
Sequence length 478
Comment pep:known chromosome:NCBIM37:8:121961018:121970156:1 gene:ENSMUSG00000074063 transcript:ENSMUST00000152420
Sequence
MTSWRHDSLGASSSEPLPVVIIGNGPSGICLSYLLSGHIPYVKPGAVHPHPLLQRKLAEA
PGVSILDQDLEYLSEGLEGRSQSPVALLFDALLRPDTDFGGSIDSVLSWKRQKDRAVPHL
VLGRNLPGGAWHSIEGSMVTLSQGQWMSLPDLQVKDWMRKKCRGLRNSRATAGDIAHYYR
DYVIKKGLSHNFVSGAVVTAVEWAKSEHGSPEVQASSPLFQVNGYLTTKDHGHQPFSLRA
RNVVLATGTFDSPAMLGIPGETLPFVHHDLSALEAALRAGTVNPTSDPVLIVGAGLSAAD
AVLFARHYNIQVIHAFRRSVHDPGLVFNQLPKMLYPEYHKVQQMMRDQSILSPSPYEGYR
SLPEHQPLLFKEDHQAVFQDPQGGQQLFGVSMVLVLIGSHPDLSYLPRAGADLVIDPDQP
LSPKRNPIDVDPFTHESTHQEGLYALGPLAGDNFVRFVQGGALAAASSLLKKETRKPP
Download sequence
Identical sequences Q8VC10
ENSMUSP00000114467 ENSMUSP00000114467 10090.ENSMUSP00000114467 ENSMUSP00000114467 354813 GO.34294 NP_082226.1.92730 XP_006531440.1.92730 XP_006531444.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]