SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117099 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117099
Domain Number 1 Region: 322-440
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-27
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 198-279
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.00000101
Family ATP sulfurylase catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117099   Gene: ENSMUSG00000033256   Transcript: ENSMUST00000125826
Sequence length 446
Comment pep:novel chromosome:NCBIM37:2:122174864:122194898:-1 gene:ENSMUSG00000033256 transcript:ENSMUST00000125826
Sequence
AVCSLSWEGPMLLSGAPPTGSGPGPRAQGSAGGGPGGSRRGAGGAGTGPGGGGSGGVAKW
LREHLGFRGGGGGGGAKPAPPEPDYRPPAPCPAAPPAPPPDILAAYRLQRDRDFEDPYSG
GPSASAALSTPAVPGPTPPPRHGSPPHRLIRVETPGPPAPPPDSGPPASSDRLAILEDYA
DPFDVQETGEGSGGTSGAPGKVPENDGYMEPYEAQKMMAEIRGSKETAAQPLPLYDTPYE
PEDEGASPEGEGTPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAAQFEGSENCLSP
GREEKGRLPPRLSAGNPKSAKPLGMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLL
RLCKEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVH
HYASRKLPIKGAEHMSLLYPVAIRTL
Download sequence
Identical sequences A2AQ87
ENSMUSP00000117099 ENSMUSP00000106160 ENSMUSP00000117099 10090.ENSMUSP00000117099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]