SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117686 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117686
Domain Number 1 Region: 1955-2190
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-54
Family DBL homology domain (DH-domain) 0.0000352
Further Details:      
 
Domain Number 2 Region: 2190-2314
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-31
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 1762-1825
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000117686
Domain Number - Region: 165-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000146
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117686   Gene: ENSMUSG00000066406   Transcript: ENSMUST00000147005
Sequence length 2794
Comment pep:novel chromosome:NCBIM37:7:82600420:82899495:1 gene:ENSMUSG00000066406 transcript:ENSMUST00000147005
Sequence
MKLSPQQAPLYGDCVVTVLLAEEDKVEDDAIFYLIFSGSTLYHCTSTRKVSSDTLETIAP
GHDCCETVKVLLCASREGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
RSGPPSRDVNSLDEKVALAFRHLKLPAEWNVLGTDHTLHDGGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNKEGATPVSLALERGYHELHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESESHREPHGDSCTGHISKLMNIQQQLMKTNLKQMDNLMPLMV
TAQDSSCVPSVPETDGLFLPCVPEPSDHQHPPFEETKSTLCCQRSPGRMAESSCDLSSMV
EEENVICSHKKNKDVGRKGEEAEPASAMDSGSASHQDSCLQSVPDCGVKGREGLPSCGNR
NEVTGTNYSGVATCQQPLSSRSSVLQDAMVTEPDACQHSSGRELPDSSSTDVGAPEKAGE
LEHSLLTPDATTQNNKPQVGEGTKERLENSDSSTTETTAVQVLSEPMEKADITNHVFATS
AVGVNTPAEASPALSSEEIPTEKPGMETQERGCEGGTTSDQSSPVLPAAAIENKVLGGQE
PDTSIAGFCKTASPLDLTMPGPSSDGMPEQNSESHARPAQSLSGQALLCSTAEAGTPSAE
ATHQPSTVTSSGRLEECGSGKASLPESTMVQPSTQELCTTLCPEDPQADTVTSDTVKNTQ
KSVGVCHLCVSDAKNQGNGLKQDTPLTNVLEDVPRLPSVVSQTEKELAPDQVSPPASSFS
LASSPESESVTKDDALSLVPSQKEKGTATPQLHRTTACRDGPDGRDLSDTDKVGDGATDP
PPSSAVELRTSMGNTSPVGIGGEQEGSSPTATLEVLSDSLLHNVDKAALVSDFTLPEEGV
SVVVPESSTALGQDGKDRAMSCSSVKEDVHSSEMSREDQRTPPSGQEIPGLCEKPMSALC
AEEKAQQHTPSACLKTETKDIKEVAPQVSLLTEGGAAKSLVPPRTSLSADSKQKASSTEQ
SGSSLLPSGLPGASEALHCNQPSALDVVVENTQFQGETNACEVSRSAMEDVTVADASPAT
AEPRKKDASHCIKDIPISELLNQEKQMTPSLPEAFLDKGVTDLQEVITPEIEPLDCKRET
LEGTDLNCATSNSKETPIEKPMQPLARDLPTETGLSVINNNVPQADMKQVAQASIPAEES
NATTVSTQAADVPTRADSIEETATRIVEAVIRQVRASNALMAKVETQNPSLSSPETKQLE
NAYTESACAFLPGETPQIEKTHEDTTGQCGAETEEPEKIILPESAPEMPDTRTGDEVDLL
SRISAASEEEAVGNGAATPKMKQGPGTQAINRESWCAIEPCPEAASLLASKQSSECRSFI
DVGLGTECASKEGMLQRVSGSESDLFHSPSDEMDSIIFPKPEEEQLLCDTTGSSSSTDDT
ASLDRHSSHGSDVSLPQTSKLNRSRNHQSANGFFSPGVEAPESRESESEPAGSGEMEEEE
MDSITEVPANCSFLRSSMRSLSPFRRHSWGPGKNAASDAEMNQRSSMRALGHVVRRPPIH
RRSMSWCPSGVQYSAALNADFNIRSFSLEGLTGGGVGNKPSSSLEMSSANSSELRNPFGG
EEQRNSLMSLSEEHLEPDQRQHHRMFDQQTCYRSKQQGFNYCTSAISSPLTKSISLMTIS
HPGLDSSRPFHSTSANLTESITEENCNFLPPSPSKKNFEEKSGTKVSRTFSYIRNKMSSS
KKSKEKEKEKDKIKEKEKDSKEKEKDKKTLNGHTFSPIPIVGPISCSQCMKPFTNKDAYT
CAGCGAFVHKGCRENLASCAKVKMKQPKGSLQAHDTSSLPTVIMRNKSSQPKERPRSAVL
LADEATAAPMFTNRRSQQSVSLSKSVSIQNITGVGNDENMSNTWKFLSHSTDSLNKICKV
NESTESLTDEGVGTDMNEGQLMGDFESDSKQLEAESWSRTVDSKFLKQQKKDVVKRQEVI
YELMQTELHHIRTLKIMSDVYSRGMMTDLLFEQQMVEKLFPCLDELISIHSQFFQRILER
KKESLVDKSEKNFLIKRIGDVLVSQFSGESAERLKKTYGKFCGQHNQSVNYFKDLYTKDK
RFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVEQEDLTQSLS
LVKDVIGAVDSKVASYEKKVRLGEIYTKTDSKSIMRMKSGQMFAKEDLRRKKLVRDGSVF
LKSTTGRLKEVQAVLLTDILVFLQEKDQKYVFASLDHKSTVISLKKLIVREVAHEEKGLF
LISMGVKDPEMVEVHASSREERNSWIQIIQDTINSLNRDEDEGIPSENEEEKKLLDTKAR
ELKEQLQQKDQQILLLLEEKEMIFRDMTECSTPLPEDCSPTHSPRVLFRSNTEEALKGGP
LMKSAINEVEILQSLVSGSLGGTLGQSISSPVEQEVMAAPISLPRRAETFGGFDCHQMNA
SKGGEKEEGDDGQDLRRTESDSGLKKGGNGNLVFMLKRNSEQVVQSIVHLHELLSMLQGV
VLQQDSYIEDQKLVLTEKVLTRSASRPSSLIEQEKQRSLEKQRQDLANLQKQQAQHLEEK
RRREREWEAREQELRDREAKLAEREETVRRRQQDLERDREELQQKKGTYQCDLERLRAAQ
KQLEREQEQLRRDTERLSQRQMDQNLCQVSNKHGRLMRIPSFLPNSDEFSSPSAPSVTKS
GSLDSELSVSPKRNSISRTQKDKGPFHILGSASQTKVPEGQSQAPSSTSTSTRLFGLSKP
KEKKEKKKKSKGSRTQPGDGPASEVPAEGEEIFC
Download sequence
Identical sequences A0A140LJJ5
ENSMUSP00000091865 10090.ENSMUSP00000117686 XP_006541319.1.92730 ENSMUSP00000117686 ENSMUSP00000117686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]