SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118046 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118046
Domain Number 1 Region: 44-809
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-277
Family Motor proteins 0.000000000169
Further Details:      
 
Domain Number 2 Region: 2005-2094
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-19
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 3 Region: 1888-2004
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-19
Family Second domain of FERM 0.0038
Further Details:      
 
Domain Number 4 Region: 1189-1291
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000708
Family Ubiquitin-related 0.052
Further Details:      
 
Domain Number 5 Region: 1787-1896
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000107
Family Ras-binding domain, RBD 0.051
Further Details:      
 
Domain Number 6 Region: 1283-1377
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000122
Family Second domain of FERM 0.0067
Further Details:      
 
Domain Number 7 Region: 1502-1566
Classification Level Classification E-value
Superfamily SH3-domain 0.000000445
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 8 Region: 816-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000276
Family Motor proteins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118046   Gene: ENSMUSG00000024388   Transcript: ENSMUST00000134663
Sequence length 2113
Comment pep:known chromosome:NCBIM37:18:32118888:32196615:-1 gene:ENSMUSG00000024388 transcript:ENSMUST00000134663
Sequence
MSVFRLGDHVWLDPPSSSKTGVAIGGIVKETKLGKTLIEDDEGKEHWVHAEDLSTLRPMH
PNSAQGVDDMIRLGDLNEAGVVHNLLIRYQQHKIYTYTGSILVAVNPFQMLPLYTLEQVQ
IYYSRHMGELPPHIFAIANSCYFNMKKNKRDQCCIISGESGAGKTETTKLILQFLATVSG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNSSGVIEGASIEHFLLEKS
RVCRQAPEERNYHIFYCMLMGMSPEEKQMLSLGMPSEYHYLTMGSCTSSEGLSDAKDYAH
VRSAMKILQFSDSENWDISKLLAAILHLGNVGFMAAVFENLDSSDVMETPAFPLAMKLLE
VQHQALRDCLIKHTIPVLGEFVSRPVNIAQATDRRDAFVKGIYGRLFQWIVKKINAAIFT
PQAQDPQNVRRAIGLLDIFGFENFQNNSFEQLCINFANEHLQQFFVKHVFTMEQEEYLSE
NITWNYIHYTDNQPILDMLALKPMSIISLLDEESRFPQGTDVTMLQKLNSIHANNKSFLS
PRSIHDTRFGIAHFAGDVYYQAEGFLEKNRDVLSTDILILIHSSKNKFLKEIFNVDSSQT
KLGHGTICQVKAGSQLFKSSDSIKRPVTLASQFKQSLDQLMRILTNCQPYFVRCIKPNEY
KKPLLFDRELCIQQLRYSGMMETVHIRKSGFPIRYTFDEFSQRFRVLLPSPERMQFQNKP
RQMTLHIADLCLGTDKDWKVGKTKIFLKDHQDTVLEIRRSQALDGAAIRIQRVLRGHKYR
KEFLRQRRAAVTLQAGWRGYSQRKNFKLILVGFERLQAIARSHLLMRQFQAMRQRIVQLQ
ARCRGYLVRQQVQAKRRAVVIIQAHARGMVVRKSYWQQKSTGPQVILAKEPKAQVAVHER
KRKSIYDTVTDTAMVEKVFGFLPAMIGGQEGPAPTRFEDLEVKTQKLHEVDLDTVPMMAM
PEEEVDSLAEYTFPKFAVTYFQKSASHTHIQKPLRYPLLYHENDTDHSAALDVWIIILRF
MGDLPEPVVYGRNSLTGSSVMRQIHDKLGKDSVTQHNRSSQVASQLNFGEEAFKFDGPIS
DRPMSNLEKVHFIVGYAIMRPGLRDEIYCQICKQLSENYKTSSRARGWILLSLCLGCFPP
SERFMKYLLNFISQGPPSYGPFCAERLQRTFANGVRAEPPTWLELQAVKSKKHIPIQVIL
ATGRSLTISVDSASTSREICQHVAQKQGLRDNLGFSLQVAVYDKFWSLGSGCDHLMDAVA
QCEQLARERGESQRQAPWRIYFRKEFFTPWHDSQEDPVSTELIYHQVLRGVWSGEYNFEK
EEELVELLARHCYVQLGATVKSNAVQELLPSCVPSKLYRTKSPEKWASLVTAAHAKAQYT
QSKATPLAVREQTVEAARLLWPLLFSRLFEVTTLSGPRLPKTQLVLAINWKGMYFLDQKE
RTLLGLSFAEVMGLVANRDAPGGKKLLLATLQEEYEFVSPSSVAIAEMVALFLGGLKERS
VFAMALQDRRATDDITLLPFKKGDLLILTKKQGLLASENWALGQNDRTGKTGLVPTACLY
TIPSVTKPSTQLLSLLAMSPEKRKLAAQEVRALEPPLEDQLTESPYTLEEFSYQFFRAPE
KETISRAAMPMARSRGHLWAYSPEPLRQPLLKSVHDKAKLRDAACQIFLAILKYTGDYPS
RQSWHSLELTDQMFSLALQDPALQDELYCQILKQLTHNSIRFSEERAWQLLWLCTGLFPP
GKTLLPHAQKFIDSRKKKPLALDCSRRLHRVLRVGPRKQPPHDVEVKAAEQNVSKLHHEV
YLPNDTSKSMEVGSSSRVRDLCEGIGTRLQLASWDGCSLFIKITDKVISLKEGDFFFDSL
RQVSDWVKKNRPQKEGASVTLPYQVFFMRKLWLNVTPGKDVNADTILHYHQELPKYLRGF
HKCSREDAIHLGGLICKIQFGSDSSQLASVSKVLKELVPQNLTRLMSSEEWKKSLLLECD
KNKRKTVAEAKVEFLKYMYRWPTFGSAFFEVKQTSEPSYPDILLIAINRHGLLLIHPKTK
ELLNTYPFTKISSWSSGNTYFHMALGSLGQGSRLLCETSLGYKMDDLLTSYVQQLLNTVN
KQRGFRAPAPANP
Download sequence
Identical sequences Q99MZ6
ENSMUSP00000118046 NP_115770.2.92730 ENSMUSP00000118046 ENSMUSP00000118046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]