SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119102 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119102
Domain Number 1 Region: 25-149
Classification Level Classification E-value
Superfamily PX domain 1.83e-31
Family PX domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119102   Gene: ENSMUSG00000046032   Transcript: ENSMUST00000156473
Sequence length 170
Comment pep:novel chromosome:NCBIM37:X:98293125:98417892:-1 gene:ENSMUSG00000046032 transcript:ENSMUST00000156473
Sequence
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPI
FKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERR
QGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVLGLHWLLSMR
Download sequence
Identical sequences D4A719 Q3V2H3
ENSRNOP00000061412 ENSRNOP00000005385 ENSMUSP00000119102 ENSMUSP00000113117 NP_001102287.2.100692 NP_001102287.2.4139 NP_001103781.1.92730 XP_006257140.2.100692 XP_021043727.1.100879 10090.ENSMUSP00000119102 10116.ENSRNOP00000061412 ENSMUSP00000119102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]