SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119345 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119345
Domain Number 1 Region: 142-431
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-90
Family Protein kinases, catalytic subunit 0.000000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119345   Gene: ENSMUSG00000017376   Transcript: ENSMUST00000142739
Sequence length 527
Comment pep:known chromosome:NCBIM37:11:78380670:78510875:-1 gene:ENSMUSG00000017376 transcript:ENSMUST00000142739
Sequence
MSLCGTRANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
Download sequence
Identical sequences D3ZSZ3 K9J1M2 O54949 U3EBF5
ENSRNOP00000011726 ENSMUSP00000119345 ENSRNOP00000011726 ENSMUSP00000119345 10090.ENSMUSP00000119345 10116.ENSRNOP00000011726 NP_001178853.1.100692 NP_001178853.1.4139 NP_032728.3.92730 XP_021068265.1.100879 ENSMUSP00000119345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]