SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120977 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120977
Domain Number 1 Region: 18-129
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00000000000000191
Family Dual specificity phosphatase-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120977   Gene: ENSMUSG00000021768   Transcript: ENSMUST00000127851
Sequence length 266
Comment pep:known chromosome:NCBIM37:14:22552617:22567844:-1 gene:ENSMUSG00000021768 transcript:ENSMUST00000127851
Sequence
MADASIPKPGEEKEATPCPSILQLEELLRAGRASCSRVDEVWPNLFIGDAATANNRFELW
KLGITHVLNAAHGGLYCQGGPDFYGSSVCYLGIPAHDLPDFNISPYFSSAADFIHRALTV
PGEPVLPLCRQALPVCYSCPGPDGSLSPSGRPEDEKGPAWRSPSNPPLQQPPPAFHVPSQ
PLSSVSTETASGVRSQAARIQRHKLWVGEDYSPVRISPQNGLATEAGTSEAKDSWGSPGV
PLPATHTGLSAAIAVGPSDCHTDPHQ
Download sequence
Identical sequences D6RHL3
10090.ENSMUSP00000120977 ENSMUSP00000113305 ENSMUSP00000120977 ENSMUSP00000120977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]