SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121161 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121161
Domain Number 1 Region: 282-424
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 98-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-27
Family First domain of FERM 0.0000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121161   Gene: ENSMUSG00000027624   Transcript: ENSMUST00000125153
Sequence length 1064
Comment pep:novel chromosome:NCBIM37:2:156246820:156348500:1 gene:ENSMUSG00000027624 transcript:ENSMUST00000125153
Sequence
MTTETGPDSEVKKAQEETPQQPEAAAAVTTPVTPAGHSHPETNSNEKHLTQQDTRPAEQS
LDMDDKDYSEADGLSERTTPSKAQKSPQKIAKKFKSAICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTYCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIML
GVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSA
KRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS
SSKRYTMSRSLDGEFSRPASVSENHDAGPDGDKREDDAESGGRRSEAEEGEVRTPTKIKE
LKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWDRERRLPSS
PASPSPKGTPEKASEGSEHWVLIERVYTRPEDLGLLTVPATQREESGSSLTEILADGRLS
KVDILVDKFKVEVATEETVRAQRTSTQQQGKMIASPEGSETMREEDACLRGGPRDATRAA
GYTSTDKLKLRNTRVSNGQTESHVELNKGLERPQTWGRLTAAGVGPVQGEVLSPASDKGG
LQSFLLDPAQTEARADSSDETDTSFAERSFCLNYGKKDSEDSLLAPSLGDREEHLDAPPG
DGTWLELAGAHTENWEPKSSDPRASAPGSSQNKDEAHMASSAEEAWSPRDRGRPDDLQGS
AVCQTLEEGWENTQGLEGELAYPVADVAEDEAPTSIDWMGKTEKKSPPARWKKNPPGGGG
GGGGGGGGGGGGGGGGGGRVHLDAQACALLRTIPPCVRKPVRPDQASFLPKEKGAVSTHA
VEPETEDREAVTPLPASSGHTEVLAATSLSPVPPRSGESSESRGFIRDQSPVILKYIHLP
EESPVHKDPQGERKAPPVASKKPRVVPEGTEGPALLGLVLPSGK
Download sequence
Identical sequences E9PV14
ENSMUSP00000105200 ENSMUSP00000121161 ENSMUSP00000121161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]