SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121305 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121305
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-24
Family SH2 domain 0.00000357
Further Details:      
 
Domain Number 2 Region: 104-150
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000706
Family SOCS box-like 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121305   Gene: ENSMUSG00000020027   Transcript: ENSMUST00000139210
Sequence length 201
Comment pep:known chromosome:NCBIM37:10:94847996:94875743:-1 gene:ENSMUSG00000020027 transcript:ENSMUST00000139210
Sequence
XWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRL
DSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHF
CRLAINKCTGTIWGLPLPTRLKDYLEEYKFQECGELVLSADFYGKYFPILLDPVLTTSFL
AHHYTVTTLKIKKLGAQGKVK
Download sequence
Identical sequences F6RVG2
ENSMUSP00000020215 ENSMUSP00000121305 ENSMUSP00000121305 10090.ENSMUSP00000121305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]