SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121965 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121965
Domain Number 1 Region: 337-417,563-822
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.53e-81
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121965   Gene: ENSMUSG00000038861   Transcript: ENSMUST00000125476
Sequence length 828
Comment pep:novel chromosome:NCBIM37:3:94780039:94810703:1 gene:ENSMUSG00000038861 transcript:ENSMUST00000125476
Sequence
MKFLEARSLAVAMGDMVVEPATLKPTSEPTPSPSGNNGGSLLSVITEGVGELSVIDPEVA
QKACQEVLEKVKLLHGGVAISSKGTPLELVNGDGVDNEIRCLDDPPAQIREEEDEMGAGV
ASGTAKGARRRRQNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFYFR
NEDVDFYLPQLLNMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQ
RHSRGTKLRKLILSDELKPAHRKRELPTLSPAPDTGLSPSKRTHQRSKSDATASISLSSN
LKRTASNPKVENEDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQK
TQRLISELSLLNHKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECEN
FDTTSVPARIPENRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQ
VELPEVHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDP
SAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQ
ERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLS
AQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAF
KLTTEFVDVMGGLNGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSST
IRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Download sequence
Identical sequences E9Q8A3
ENSMUSP00000121965 XP_021052033.1.100879 ENSMUSP00000119833 ENSMUSP00000121965 10090.ENSMUSP00000121965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]