SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122852 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122852
Domain Number 1 Region: 142-692,869-1064
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.56e-253
Family Motor proteins 0.00000000257
Further Details:      
 
Domain Number 2 Region: 2130-2318
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000577
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000002
Family Ras-binding domain, RBD 0.0093
Further Details:      
 
Domain Number 4 Region: 2064-2123
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0061
Further Details:      
 
Domain Number 5 Region: 1111-1164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000202
Family Motor proteins 0.045
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000122852
Domain Number - Region: 1068-1111
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0143
Family Motor proteins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122852   Gene: ENSMUSG00000039585   Transcript: ENSMUST00000136740
Sequence length 2631
Comment pep:known chromosome:NCBIM37:9:59598703:59776673:1 gene:ENSMUSG00000039585 transcript:ENSMUST00000136740
Sequence
MNVSDGGRRRFEDNEHTLRIYPGTISEGTIYCPIPARKNSTAAEVIDSLINRLHLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIAINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRKKNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEEERLAFHLKQPEE
YHFLNQITKKPLRQSWDDYCYDSEPDCFTVEGEDLRHDFERLQLAMEMVGFLPKTRRQIF
SLLSAILHLGNISYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEALVTRKTVTVGE
KLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEQDTKTLSIGVLDIFG
FEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLIS
KKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEENSYIEFPAVMEPAFIIKHYAGKVKYG
VKDFREKNTDHMRPDIVALLRSSRNAFVSGMTGIDPVAVFRWAVLRAFFRAVVAFREAGK
RHIQRKSGHDDTTPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSD
LQGMNTLNEKNQHDTFDIAWNVRTGIRQSRLPASNTSLLDKDGIFAHSASSKLLERAHGI
LTRNKNFRSKPVLPKHLLEVNSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLS
KLMETLGQAEPYFVKCIRSNAEKLPLRFSDALVLRQLRYTGMLETVRIRQSGYSSKYSFQ
DFVSHFHVLLPQHIIPSKFNIQDFFRKININSDNYQVGKTMVFLKEHERQHLQDLLHQEV
LRRIVLLQRWFRVLLSRQQFLHLRQASIIIQRFWRNYLNQKQVRNAAVEKDAFIMASAAS
LLQASWRAHLERQRYLELRAAAVIIQQRWRELYRCRHKAATCIQSRWRGYRQRKKYKEQR
NKIILLQSIYRGFRARQRCNALKEEKLREAKLEHGLVHVKACGPLEIQGSDPSEWEDRSF
DNRVKAIEECKYVIESNRISRESSMDFSKESPDKQQERGRRQSGTDLQEDVIVRQRPKSL
EDLHQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGMSPSEERRWSTELMPEGLQSPH
GTPDSESSQGSLELLTCDENQKSKPESLILDEGELKISSPNTFTNPKSQDNALSASSETS
STLAGKGASSDSEHLKNGTAKEKLVCSSEPITCKPQLRDSFVSSSLPTFFYIPHQEALKT
SSHLDTSIQRNKLPEREAILKTTLTQDINREARKCQFSGDQMTPLNTDSSCTVLKKLEKL
NIEKEKRQKQLQQQNEKEMMEQIRQQTDILEKERKAFKTIEQSRTEASVLAPSFYQPRQK
VERPCSLYIQNTPSKGEAGVLGSPSAVTKRDAALATKDSPSIHLPPKDRPVTLFFEKKGS
PCQSRTVKELPKTERTGTQHDAAYKLSNNRSTERDHFKSTHFYSHRSDDPSREGSSRAIF
FTPKDNITPLVHSGNPQAHKQDESAWKPKLAGPGQQEVARPAHKKKARMARTRSDFLTRG
TFAEGEGDTEEDDYDDIIEPLLSLDQASHSELGPVSSLGQASHSDSEMTSQRFSSVDEQA
KLHKAMSQGEITKLAVRQKASDLDIRPQRAKMRFWAKGKQGEKKTTRVKPASQSEISSFF
PGPDVTPAHPFSDELTQYHPTPPLSPELPGSCRKEFKENKEPSPKAKRKRGVKISSVALD
SMHWQNDSVQIIASASDLKSMDEFLLKKMNDLDNEDSKKDTLVDVVFKKALKEFRQNIFS
SYSSALAMDDGKSIRYKDLYALFEQILEKTMRLEQRDWNESPVRVWVNTFKVFLDEYMNE
FKTLDSTAPKVLKTERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRAS
VCKLCKYACHKKCCLKTTAKCSKKYDPELSSRQFGVELSRLTSEDRAVPLVVEKLINYIE
MHGLYTEGIYRKSGSTNKIKELRQGLDTDAESVNLDDYNIHVIASVFKQWLRDLPNPLMT
FELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEDTNRMSAN
ALAIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAENK
AKTRLSLIRRSMKPVLIAVRFMSITRSSVSGKGRIHRGNYPSPSSPVIVRLPSMSDVPEE
TLSSETAMETDLTDQQQAAMQQEEKVLTEQIENLQKEKEELTFEMLVLEPRASDDETLES
EASIGTADSSENLNMDSEERSLALSSLKAAGKSEPSSKSRKQLRKQPDSLDSVSSSVSSC
LSNTTSSHGTRKRFQIYSKSPFYRAASACEAQGTEGPLGQAKSLEDRPQFISRGTFNPEK
GKQKLKNVKNSPQKTKETPEGTVTSGRKKTVDSDCSSTQQLPLFGNNEFMV
Download sequence
Identical sequences D3Z3A8
ENSMUSP00000122852 ENSMUSP00000117432 ENSMUSP00000122852 NP_766606.2.92730 10090.ENSMUSP00000122852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]