SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123090 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123090
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-39
Family Dual specificity phosphatase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123090   Gene: ENSMUSG00000042662   Transcript: ENSMUST00000123121
Sequence length 235
Comment pep:known chromosome:NCBIM37:2:152766731:152777434:-1 gene:ENSMUSG00000042662 transcript:ENSMUST00000123121
Sequence
MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIHESPQPLLQDITYLRISVSDTPE
VPIKKHFKECVHFIHSCRLNGGNCLVHCFAGISRSTTIVIAYVMTVTGLGWQEVLEAIKA
SRPIANPNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEEDLRALLPLCRRCRQGSA
TSAASATTASSAAEGTLQRLVPRSPRDSHQPLPLLARVKQTFFCLPRCLSRKGGK
Download sequence
Identical sequences Q8R4V2
ENSMUSP00000123090 ENSMUSP00000123090 ENSMUSP00000045815 10090.ENSMUSP00000123090 NP_001152848.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]