SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124022 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124022
Domain Number 1 Region: 243-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.36e-31
Family Laminin G-like module 0.068
Further Details:      
 
Domain Number 2 Region: 627-769,799-818
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000024
Family Reprolysin-like 0.061
Further Details:      
 
Domain Number 3 Region: 1522-1596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1588-1645
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000862
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number 5 Region: 843-897,1065-1108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000166
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 6 Region: 543-632,721-773
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000023
Family Zinc protease 0.079
Further Details:      
 
Domain Number 7 Region: 1481-1528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000653
Family Complement control module/SCR domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000124022
Domain Number - Region: 1408-1465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00109
Family Complement control module/SCR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124022   Gene: ENSMUSG00000073530   Transcript: ENSMUST00000159861
Sequence length 1789
Comment pep:known chromosome:NCBIM37:1:160641862:160887870:-1 gene:ENSMUSG00000073530 transcript:ENSMUST00000159861
Sequence
MMCWKVLRISLVVLTGWALSTTNSEQGWTRKKFLAQKEHLNQVLLEGERCWLGYKVRRPR
TAPQHHLFGVYPSRLENYPRSYPVGTQQQTLYAEWSQRSPERQAPSGIPRDLTENPAGAR
RESQQPAAPWVGDGPIGQSQLLRNDDTYLGEGGSKEALGEPAIQGSSEIAVSTIATFAYQ
KGPTAETQRKGQSKSRLPRQVQKRQAEDMTGDPQNTPQGFQLWPKEPLKHGDSDSPLEGT
IQNGGGASLRRVETFNSQGGLPVLYFTGKRERLLLRPEVLAEIPREAFTVEAWVRPEGGQ
SNPAIIAGVFDNCSHTVNDKGWALGIRSGKDKGWRDARFFFSLRTDRMKKATIVTGHSRY
QPGMWTHVAATYDGQHTALYVDGTRVASSRDQFGPLNSPFMASCRSLILGGDSSEDGHYF
RGYLGTLVIWSTALSQTHLQHSPLHPSAADELTTLILTATFDPLMEQWAPFRDDLYPRLE
VLQDSESQPEILSPLQPPPCGQTACDNVELISQYNKHGPLRREKVIRYQVVNIYDDEGLH
PIVSDHQIRRQHEALNQAFSRYNISWQLSVHRVHNSTLRHRVVLVNCEPSKIGNDHCDPE
CEHPLTGFDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVTDVRKTCFDP
DSPKRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGSATWPWDKEALSHLGGVVLNP
TYYGMLGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPK
SKLCRDPEPANDTCGFTLFPGAPFNNYMSYTDDECTDNFTPNQVARMHCYLDLVYQQWSE
SQKPTPIPIPPMVIGQTHKSLTIHWLPPISGVVYDRAPDSMCSACTEDGTFRQYVYKASS
GRVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLNHMNMTVPCPAEGCSLELLFQY
PVQADTLTLWVTYLSMNSSKAFFDIEILLEHKKSMHLGPLNTFCDIPLTIKLHMDEKVMG
AKVYTFDERMEIDAALLTSRPNSSLCSGCKPMSYQVLREPPFSSGLPMVVTHPHRKFTDT
EVIPGQMYQYQVQAEAVGELGEASPPLSHIHGGPYCGDGKVERSIGEMCDDGDLLNGDGC
SRACELEEGFNCAGEPSLCYRYEGDGVCEDFEKESIITDCGLHTPEGYLDQWASQAYSYH
EDKEKCPVSLVTGEPHSMICTSWHPDSSPYHSFPGWFPCVFSLKKDQDAGSEQAKDSLQK
DNEIWLEVCFNRPGVAVAIYIFLASDGVTPGEHQQATVTLYLIDVSGSNHSLGTYGLSCQ
QNPLVINVSHHVNVYPQHTSSMLLNFSSPLVGISAVALRTSSQTSSSAPSNCIPEQNYEG
KSCAQRPCGEQGRCAPLLLDHTDMVNCTSSSPGHMECAITCQRGYVLQTSSGQYLRNMQK
EILLTCSSGHWDKDVICKRLDCGVPDSSLVNYANFSCLEGTDFLKQCSISCVPPAKLQGL
NPWLTCLEDGLWSLPEVYCKLECEAPPVIPNANLLLPHFLEGNHDVGTICKYECKPGYYV
KETSGSQGKNKFLKIQCLDDGSWEQGSCVPVVCEPPPPVFEGMYECTDGFKLDSQCVLNC
NQETEGIPILCTKEGLWTQEFKLCENLQGECPPPTSELNSVEYKCGQGYGIGAVCSPSCV
IPPSDPVILPENVTTDTLEHWMEPVKVQSIVCTGRRQWHPDPSLVHCIQSCEPFQADGWC
DTINNRAYCNYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences E9PZ87
NP_001078845.1.92730 XP_006496886.1.92730 XP_006496887.1.92730 XP_011237108.1.92730 ENSMUSP00000124022 ENSMUSP00000124022 ENSMUSP00000124022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]