SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124312 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124312
Domain Number 1 Region: 296-447
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.26e-41
Family Dual specificity phosphatase-like 0.00025
Further Details:      
 
Domain Number 2 Region: 250-298
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000915
Family DEK C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124312   Gene: ENSMUSG00000042121   Transcript: ENSMUST00000159592
Sequence length 1042
Comment pep:known chromosome:NCBIM37:5:114387103:114443903:-1 gene:ENSMUSG00000042121 transcript:ENSMUST00000159592
Sequence
MALVTLQRSPTPSAASSSASNSELEAGSDEERKLNLSLSESFFMVKGAALFLQQGNSPQG
QRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESVWTDRVRYMVVVYTSGRQDTE
ENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWS
ALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPAL
FVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKEFKEFIDNEML
LILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRV
YDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAY
NYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQPTDDTIAEPSEFLPETLDG
ALDAQLPCLDDTTHPGLPRSLAPGGPALPCCFRRLSDPLLLPHHDETGGLVHLEDLEKDA
LLEEEESQPVEVHKLVQHPQEGARLCEKDVKRKLEFGNSKPRSDSLPQVEELEKDGSPRT
GRWRRASTQLDRSLLDQENLNNNNSKRSCPDDLERDAMFGILSKVKPPYTSCADCMYPTA
GGTPEAYMERHEDPSSSAICTQPTFLPHVTSSPMAHASSRSRAPERPASGPANTSPFLLP
AGSRKPDVSGSGAGAAPEPPASLLEPSRETSKALPKSLQLKNPHCDKNAANMEVSAKEEP
SPKKDPKPAKDLRLLFSNEAEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSLPS
DSPAACRDSATCRLEASIPEEGSQEPAHPALCSQAGSEEQPVGGTLQKSPTSTLPRLDHT
SNFSKDFLKTVCYTPTSSSISSNLTRSSSSDSIHSVRGKPGLVKQRAQEIETRLRLAGLT
VSSPLKRSHSLAKLGSLNFSTEDLSSEADTSTIADSQDAKCGLSSSFLPEPQSAPRDPAA
TSKSSGKSAPEHLKSPSRVNKS
Download sequence
Identical sequences Q76I79
ENSMUSP00000124312 NP_932777.2.92730 10090.ENSMUSP00000076873 ENSMUSP00000124312 ENSMUSP00000076873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]