SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126092 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126092
Domain Number 1 Region: 1042-1391
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-95
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000307
Further Details:      
 
Domain Number 2 Region: 846-1036
Classification Level Classification E-value
Superfamily ARM repeat 7.48e-54
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000928
Further Details:      
 
Domain Number 3 Region: 353-521
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-44
Family Ras-binding domain, RBD 0.021
Further Details:      
 
Domain Number 4 Region: 678-842
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.16e-34
Family PLC-like (P variant) 0.028
Further Details:      
 
Domain Number 5 Region: 1421-1539
Classification Level Classification E-value
Superfamily PX domain 1.09e-27
Family PX domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1565-1681
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.07e-24
Family Synaptotagmin-like (S variant) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126092   Gene: ENSMUSG00000030660   Transcript: ENSMUST00000170430
Sequence length 1686
Comment pep:known chromosome:NCBIM37:7:123480790:123586972:-1 gene:ENSMUSG00000030660 transcript:ENSMUST00000170430
Sequence
MAQISNNSEFKQCSSSHPEPIRTKDVNKAEALQMEAEALAKLQKDRQMTDSPRGFELSSS
TRQRTQGFNKQDYDLMVFPELDSQKRAVDIDVEKLTQAELEKILLDDNFETRKPPALPVT
PVLSPSFSTQLYLRPSGQRGQWPPGLCGPSTYTLPSTYPSAYSKQATFQNGFSPRMPTFP
STESVYLRLPGQSPYFSYPLTPATPFHPQGSLPVYRPLVSPDMAKLFEKIASTSEFLKNG
KARTDLEIANSKASVCNLQISPKSEDINKFDWLDLDPLSKPKVDYVEVLEHEEEKKDPVL
LAEDPWDAVLLEERSPSCHLERKVNGKSLSGATVTRSQSLIIRTAQFTKAQGQVSQKDPN
GTSSLPTGSSLLQEFEVQNDEVAAFCQSIMKLKTKFPYTDHCTNPGYLLSPVTVQRNMCG
ENASVKVSIEIEGLQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYILKVCGQEE
VLQNNHCLGSHEHIQNCRKWDTEIKLQLLTLSAMCQNLARTAEDDEAPVDLNKYLYQIEK
PYKEVMTRHPVEELLDSYHYQVELALQTENQHRAVDQVIKAVRKICSALDGVETPSVTEA
VKKLKRAVNLPRNKSADVTSLSGSDTRKNSTKGSLNPENPVQVSMDHLTTAIYDLLRLHA
NSSRCSTGCPRGSRNIKEAWTATEQLQFTVYAAHGISSNWVSNYEKYYLICSLSHNGKDL
FKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGVLNQSSGSSPDSNK
QRKGPEALGKVSLTLFDFKRFLTCGTKLLYLWTSSHTNSIPGAIPKKSYVMERIVLQVDF
PSPAFDIIYTSPQIDRNIIQQDKLETLESDIKGKLLDIIHRDSSFGLSKEDKVFLWENRY
YCLKHPNCLPKILASAPNWKWANLAKTYSLLHQWPPLCPLAALELLDAKFADQEVRSLAV
SWMEAISDDELADLLPQFVQALKYEIYLNSSLVRFLLSRALGNIQIAHSLYWLLKDALHD
THFGSRYEHVLGALLSVGGKGLREELSKQMKLVQLLGGVAEKVRQASGSTRQVVLQKSME
RVQSFFLRNKCRLPLKPSLVAKELNIKSCSFFSSNAMPLKVTMVNADPLGEEINVMFKVG
EDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFRCLSTGRDRGMVELVPASDTLRKIQVEY
GVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAY
NLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLG
SIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDK
HYIYVVRILREGHLEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVA
AKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSAGAVPFSPTLGQIG
GAVKLSVSYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTKISRKTRN
PTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGITLPLKDFNLSKETVKWYQL
TAATYL
Download sequence
Identical sequences F8VPL2
NP_035213.2.92730 XP_006507503.1.92730 ENSMUSP00000126092 ENSMUSP00000126092 ENSMUSP00000126092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]