SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126263 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126263
Domain Number 1 Region: 140-305
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.21e-37
Family Dual specificity phosphatase-like 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000126263
Domain Number - Region: 667-738
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.051
Family BCR-homology GTPase activation domain (BH-domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126263   Gene: ENSMUSG00000038042   Transcript: ENSMUST00000166560
Sequence length 808
Comment pep:known chromosome:NCBIM37:13:48673239:48721033:-1 gene:ENSMUSG00000038042 transcript:ENSMUST00000166560
Sequence
MAAGVLPQNEDPYSTLVNSSGHAAHMDGEEKMLILRHLTDPVWMWSRVFCRLELAEPLRE
SILLVTASAMLKLRFLTRLSSGLSCCILENSGRPAPKYTKVGERLRHVIPGHMACSMACG
GRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYRIIEQFLGQGIKTII
NLQRPGEHASCGSALEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTF
ALQEGKVAVHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVRE
FTQFLAPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKYVPKIIHLVCKLLLDL
AENRPVVMKSMLEGPVLSAEIEKTVSEMVTLQLDQELLRQNSDVPDPFNPTAEVAEFENQ
DVILSTEQEFDPLWKRRDIECLQPLTHLKRQLSYSDSDLKRAKAILEQGETPWTVPAQEL
LDHSLQHQKPTSHCYMPPTPELGFNKEALVQNTFSFWTPSKCGGLEGLKDEGSLLLCRKD
IPKEVQRSRTFSVGVSCSHNPGEPVPPNFTSIHKDPEQVTHCRCEAPGGWVPGPVHEMVR
SPCSPLNCGSSPKAQFPHGQETQDSTDLSEAVPHAGLQPELSAEARRILAAKALANLNEF
VEKEEVKRKVEMWQKELNSREEAWERICGERDPFILCSLMWSWVEQLKEPVITKEDVDML
VDRQADAAEALFLLEKGQYQTILCVLHCIVSLQTLPMEVEEACLLHAIKAFTKVNFDSEN
GPIVYDTLKKIFKHTLEEKRKMAKDSLS
Download sequence
Identical sequences ENSMUSP00000126263 NP_001288710.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]