SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126279 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126279
Domain Number 1 Region: 882-1197
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.22e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000119
Further Details:      
 
Domain Number 2 Region: 1155-1455
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.44e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000915
Further Details:      
 
Domain Number 3 Region: 33-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-39
Family MAM domain 0.0000044
Further Details:      
 
Domain Number 4 Region: 392-589
Classification Level Classification E-value
Superfamily Fibronectin type III 5.73e-25
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 289-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000153
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 6 Region: 195-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000565
Family I set domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126279   Gene: ENSMUSG00000019889   Transcript: ENSMUST00000166468
Sequence length 1457
Comment pep:known chromosome:NCBIM37:10:27794626:28317203:1 gene:ENSMUSG00000019889 transcript:ENSMUST00000166468
Sequence
MDVAAAALPAFVALWLLYPWPLLGSALGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVS
AQEPHYLPPEMPQGSYMVVDSSNHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPG
TLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYIA
IDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPVA
QTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLIVREPPRPIAPPQLL
GVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYEI
RVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRCH
TFNVTICYHYFRGHNESRADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEET
IIQTDEDVPGPVPVKSLQGTSFENKIFLNWKEPLEPNGIITQYEVSYSSIRSFDPAVPVA
GPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVKGFGPATAINVTTNISAPSLPDYEG
VDASLNETATTITVLLRPAQAKGAPISAYQIVVEQLHPHRTKREAGAMECYQVPVTYQNA
LSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYKGFWNPPLAPRKGYNIYFQAMSSVEKET
KTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVIVIVKKSKLA
KKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSLTFMDQHNFSPRLPNDPLVPTA
VLDENHSATAESSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFK
EEYESFFEGQSASWDVAKKDQNRAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDI
WLYRDGYQRPSHYIATQGPVHETVYDFWRMVWQEQSACIVMVTNLVEVGRVKCYKYWPDD
TEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHGVPYHATGLLS
FIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSRRI
NMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNS
VTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPA
AFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGPIQVECM
SCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQVEKWQ
EECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNMVEAP
EQYRFCYDVALEYLESS
Download sequence
Identical sequences P35822
ENSMUSP00000126279 NYSGRC-IgSF-P35822 NYSGXRC-8618b ENSMUSP00000126279 NP_033009.1.92730 10090.ENSMUSP00000020042 ENSMUSP00000126279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]